-- phpMyAdmin SQL Dump -- version 2.9.0.2 -- http://www.phpmyadmin.net -- -- Host: localhost -- Generation Time: Mar 06, 2007 at 01:53 AM -- Server version: 4.1.21 -- PHP Version: 4.4.2 -- -- Database: `josephcr_test` -- -- -------------------------------------------------------- -- -- Table structure for table `default_table` -- CREATE TABLE `default_table` ( `biz_id` int(11) NOT NULL auto_increment, `biz_name` varchar(255) NOT NULL default '', `address` varchar(255) NOT NULL default '', `city` varchar(100) NOT NULL default '', `state` varchar(100) NOT NULL default '', `zip` varchar(20) NOT NULL default '', `phone` varchar(20) NOT NULL default '', `url` varchar(255) NOT NULL default '', `email` varchar(255) NOT NULL default '', `description` text NOT NULL, `hours` varchar(100) NOT NULL default '', `details` text NOT NULL, PRIMARY KEY (`biz_id`) ) ENGINE=MyISAM DEFAULT CHARSET=latin1 AUTO_INCREMENT=2582 ; -- -- Dumping data for table `default_table` -- INSERT INTO `default_table` VALUES (1, 'Animal Shelters', '1201 Parkwood Drive', 'Anniston', 'AL', '36201', '(256) 236-1581', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2, 'The Dog Pound', '1701 US Highway 72 West', 'Athens', 'AL', '35611', '(256) 771-7889', 'http://www.the-dog-pound.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (3, 'Atmore City - Animal Shelter', '206 Cindebran Drive', 'Atmore', 'AL', '36502', '(251) 368-0859', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (4, 'Birmingham City - Animal Control', '6227 5th Avenue North', 'Birmingham', 'AL', '35212', '(205) 591-6522', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (5, 'Blount Co Of Animal Shelter', '120 Shelter Drive', 'Cleveland', 'AL', '35049', '(205) 625-6026', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (6, 'Cullman City - Animal Shelter', '935 Convent Road Northeast', 'Cullman', 'AL', '35055', '(256) 734-5448', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (7, 'Decatur City - Animal Shelter', '1802 Central Parkway Southwest', 'Decatur', 'AL', '35601', '(256) 341-4790', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (8, 'S O S Animal Shelter', '25944 Highway 134', 'Enterprise', 'AL', '36330', '(334) 393-1743', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (9, 'S A F E-Saving Animals From Euthanasia', '10025 Al Highway 55', 'Florala', 'AL', '36442', '(334) 858-2955', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (10, 'Lauderdale County - Animal Shelter', '702 East College Street', 'Florence', 'AL', '35630', '(256) 760-6676', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (11, 'National Disaster Animal Relief And Supply', '403 Hoke Street', 'Gadsden', 'AL', '35903', '(256) 547-0343', '', '', '', '', ''); INSERT INTO `default_table` VALUES (12, 'Four Paws Pet Salon', '1609 Henry Street', 'Guntersville', 'AL', '35976', '(256) 582-3184', '', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (13, 'Rockinp Rescue', '885 Roy Webb Road', 'Jacksonville', 'AL', '36265', '(256) 435-3849', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (14, 'Montgomery County - Humane Society', '1150 John Overton Drive', 'Montgomery', 'AL', '36110', '(334) 409-0622', '', 'mgmhs@montgomeryhumane.com', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (15, 'Society for Prevention of Cruelty To Animals', '1150 John Overton Drive', 'Montgomery', 'AL', '36110', '(334) 409-0622', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (16, 'Humane Society Animal Shelter', '1150 John Overton Drive', 'Montgomery', 'AL', '36110', '(334) 409-0622', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (17, 'Owens Cross Roads Animal Clinic', '9221 Highway 431 South', 'Owens Cross Roads', 'AL', '35763', '(256) 582-3184', '', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nHills & IAMS Pet Foods, Small Animals\n'); INSERT INTO `default_table` VALUES (18, 'Animal Shelter of Pell City', '1071 Airport Road', 'Pell City', 'AL', '35128', '(205) 814-1567', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (19, 'Scottsboro Animal Shelter', '222 Howard Street', 'Scottsboro', 'AL', '35768', '(256) 259-6511', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (20, 'Animal Rescue Foundation', '41 Shelter Lane', 'Sylacauga', 'AL', '35151', '(256) 245-2500', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (21, 'Talladega City - Animal Control Department', '809 West McMillian Street', 'Talladega', 'AL', '35160', '(256) 362-5856', 'http://www.talladega.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (22, 'Tuscaloosa Metro Animal Shelter', '3140 35th Street', 'Tuscaloosa', 'AL', '35401', '(205) 752-9101', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (23, 'International Insurance Society University of Alabama', '445 Alston Hall', 'Tuscaloosa', 'AL', '35401', '(205) 348-8974', '', '', '', '', ''); INSERT INTO `default_table` VALUES (24, 'Humane Society of West Alabama', '1515 Veterans Memorial Park', 'Tuscaloosa', 'AL', '35404', '(205) 554-0011', 'http://www.humanesocietyofwa.org', '', '', 'Saturday 10:00am To 2:00pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (25, 'Humane Society', '3265 Fairfax By-Pass', 'Valley', 'AL', '36854', '(334) 756-9377', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (26, 'Fairbanks North Star Borough Animal Control Shelter', '2408 Davis Road', 'Fairbanks', 'AK', '99701', '(907) 459-1451', '', '', '', '', ''); INSERT INTO `default_table` VALUES (27, 'Juneau Raptor Center', '2 Marine Way Suite 206', 'Juneau', 'AK', '99801', '(907) 586-8393', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (28, 'Animal Shelter', '7705 Glacier Highway', 'Juneau', 'AK', '99801', '(907) 789-0260', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (29, 'Gastineau Humane Society', '7705 Glacier Highway', 'Juneau', 'AK', '99801', '(907) 789-0260', 'http://www.ghspets.org', '', '', '24 Hour Service', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nGrooming And Supplies, Whether We Do It Or You Use Our Groom Room And Do It Yourself, -Grooming Helps To Keep Your Pet health\n'); INSERT INTO `default_table` VALUES (30, 'Animal Protection', '1111 Stedman Street', 'Ketchikan', 'AK', '99901', '(907) 225-2880', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (31, 'Alaska Dog & Puppy Rescue', '2031 South Terrace Court', 'Palmer', 'AK', '99645', '(907) 745-7030', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (32, 'Heavenly Angel Horse Rescue', '5625 East 32nd Avenue', 'Apache Junction', 'AZ', '85219', '(480) 671-7388', '', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (33, 'Animal Shelter', '104 West Harvest Way', 'Benson', 'AZ', '85602', '(520) 586-3600', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (34, 'First Regional Animal Hospital', '1233 West Warner Road', 'Chandler', 'AZ', '85224', '(480) 732-0018', 'http://www.firstregionalvet.com', '', '', '24 Hour Service', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nUrgent Care, Intensive Care, Doctor Is Always On Premises, Referral Services, Behavioral Services\n'); INSERT INTO `default_table` VALUES (35, 'Humane Society-Verde Valley', '1502 West Mingus Avenue', 'Cottonwood', 'AZ', '86326', '(928) 634-7387', 'http://www.humanesocietyofsedona.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (36, 'Humane Society-Coconino Humane Association', '3501 East Butler Avenue', 'Flagstaff', 'AZ', '86004', '(928) 526-1076', 'http://www.coconinohumane.org', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nBe Kind To Animals/Spay & Neuter Your Pets\n'); INSERT INTO `default_table` VALUES (37, 'Second Chance Center for Animals', '11665 North US Highway 89', 'Flagstaff', 'AZ', '86004', '(928) 526-5964', 'http://www.secondchancecenter.org', '', '', 'Open Evenings', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nNorthern Arizona''s Premier Animal Shelter, Dog And Cat Adoptions, Weekly Low-Cost Vaccine & Spay/Neuter Clinics, Humane Education For Schools And Groups, Pet Training And Discussion Groups, Retail... (Show More)\nNorthern Arizona''s Premier Animal Shelter, Dog And Cat Adoptions, Weekly Low-Cost Vaccine & Spay/Neuter Clinics, Humane Education For Schools And Groups, Pet Training And Discussion Groups, Retail Store With Gifts And Pet Supplies, Plateauland Mobile Vet Clinic  (Show Less)\n'); INSERT INTO `default_table` VALUES (38, 'Sun Valley Animal Shelter', '7150 North 110th Avenue', 'Glendale', 'AZ', '85307', '(623) 872-7941', 'http://www.sunvalleypets.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (39, 'Sun City Animal Rescue', '7150 N 110th Avenue', 'Glendale', 'AZ', '85307', '(623) 872-7941', '', '', '', '', ''); INSERT INTO `default_table` VALUES (40, 'Help Animals Lives Today', '6625 N Massachusetts Dr', 'Kingman', 'AZ', '86401', '(928) 692-8940', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (41, 'Mutt Matchers & Friends', '1001 Buchanan Street', 'Kingman', 'AZ', '86401', '(928) 718-4364', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (42, 'Patagonia-Sonoita Creek Sanctuary', '150 Salero Canyon Road', 'Patagonia', 'AZ', '85624', '(520) 394-2400', '', '', '', '', '\nAdditional Information:
\nW along Hwy 82, then W on 4th Ave, turn S on Pennsylvania, cross the creek, and go about 1 mile to the entrance.\nDescription:
\nThe 1,350 protected acres extend downstream along Sonoita Creek for approximately 2 miles. Bordered by willows, cottonwoods, and ash, it provides a perfect sanctuary for more than 300 species of... (Show More)\nThe 1,350 protected acres extend downstream along Sonoita Creek for approximately 2 miles. Bordered by willows, cottonwoods, and ash, it provides a perfect sanctuary for more than 300 species of birds. There is also a wide array of fish and butterflies here. Tour of the preserve (Sat 9 am). (Oct-Mar: Wed-Sun 7:30 am-4 pm, Apr-Sept: Wed-Sun 6:30 am-4 pm)  (Show Less)\n'); INSERT INTO `default_table` VALUES (43, 'Arizona Animal Welfare League', '30 North 40th Place', 'Phoenix', 'AZ', '85034', '(602) 273-6852', 'http://www.aawl.org', '', '', 'Monday-Friday 11am-7pm Saturday-Sunday 9am-5pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nArizona''s Oldest & Largest, Dog Training, Operated By Pet Behavior Solutions\n'); INSERT INTO `default_table` VALUES (44, 'Arizona Humane Society - Main Office', '1521 West Dobbins Road', 'Phoenix', 'AZ', '85041', '(602) 997-7586', 'http://www.azhumane.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (45, 'Southwest Wildlife Rehabilitation & Educational Foundation', '8711 East Pinnacle Peak Road', 'Scottsdale', 'AZ', '85255', '(480) 471-9109', 'http://www.southwestwildlife.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (46, 'Tucson Wildlife Center Inc', '13275 East Speedway Boulevard', 'Tucson', 'AZ', '85701', '(520) 290-9453', 'http://www.tucsonwildlife.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (47, 'Tucson Avian Rescue and Adoption Foundation Tara', '3900 North Stone Avenue', 'Tucson', 'AZ', '85705', '(520) 747-0554', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (48, 'Humane Society Of Southern Arizona', '3450 North Kelvin Boulevard', 'Tucson', 'AZ', '85716', '(520) 881-0321', 'http://www.humane-so-arizona.org', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Additional Information:
\nLow Cost Spay/Neuter Services, Low Cost Vaccination Clinics\n'); INSERT INTO `default_table` VALUES (49, 'Humane Society of Southern Arizona - Shelter', '3450 North Kelvin Boulevard', 'Tucson', 'AZ', '85716', '(520) 327-6088', 'http://www.humane-so-arizona.org', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nWhere Your New Best Friend Is Waiting, Comprehensive Adoption Package Includes, Spay/Neuter Surgery, First Vaccinations, ID Microchip, First Free Vet Visit, 1 Month Pet Health Insurance, Feline... (Show More)\nWhere Your New Best Friend Is Waiting, Comprehensive Adoption Package Includes, Spay/Neuter Surgery, First Vaccinations, ID Microchip, First Free Vet Visit, 1 Month Pet Health Insurance, Feline Leukemia Test, Collar & Leash Or Cat Carrier, For Adoption Information Call  (Show Less)\n'); INSERT INTO `default_table` VALUES (50, 'Karyn Garvin & Associates Inc', '5007 East 29th Street', 'Tucson', 'AZ', '85711', '(520) 790-3647', 'http://www.karyngarvin.com', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nVeterinarians Recommend, Animal Behavior Specialists, Solutions For Problem Behaviors In Dogs And Cats, Agility Training, Training Available At Your Home Or Visit Our Air Conditioned Facility, Call... (Show More)\nVeterinarians Recommend, Animal Behavior Specialists, Solutions For Problem Behaviors In Dogs And Cats, Agility Training, Training Available At Your Home Or Visit Our Air Conditioned Facility, Call Now To Schedule Your Free Consultation, Specialty Products, Bark Collars Invisible Fence Pet D  (Show Less)\n'); INSERT INTO `default_table` VALUES (51, 'Animal Behavior Specialists', '5007 East 29th Street', 'Tucson', 'AZ', '85711', '(520) 790-3647', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAnimal Behavior Specialists, Dog Day Care, Agility Training\n'); INSERT INTO `default_table` VALUES (52, 'Greyhound Adoption League', '4310 South Calico Lane', 'Tucson', 'AZ', '85735', '(520) 578-2792', '', '', '', '', ''); INSERT INTO `default_table` VALUES (53, 'Animal Shelter', '1600 West Fort Grant Road', 'Willcox', 'AZ', '85643', '(520) 384-0163', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPet Shops, Animal Shelters\n'); INSERT INTO `default_table` VALUES (54, 'Winslow City - Animal Control', '548 Barrigan Road', 'Winslow', 'AZ', '86047', '(928) 289-3232', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (55, '4 Paws Rescue Bargain Boutique', '11129 West Michigan Avenue', 'Youngtown', 'AZ', '85363', '(623) 876-8778', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (56, 'Yuma County - Humane Society', '285 North Figueroa Avenue', 'Yuma', 'AZ', '85364', '(928) 782-1621', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (57, 'Bella Vista Animal Shelter', '32 Bella Vista Way', 'Bella Vista', 'AR', '72714', '(479) 855-6020', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (58, 'Berryville City - Animal Control', '305 East Madison', 'Berryville', 'AR', '72616', '(870) 423-3685', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (59, 'Humane Society of Blytheville Inc', '2530 Arizona', 'Blytheville', 'AR', '72315', '(870) 532-6698', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (60, 'Blytheville-City - Animal Shelter', '2530 Arizona', 'Blytheville', 'AR', '72315', '(870) 762-0453', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (61, 'Needy Paws Animal Shelter', '1100 East Main Street', 'Clarksville', 'AR', '72830', '(479) 754-4200', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (62, 'Van Buren County Animal Shelter', '187 Tester Street', 'Clinton', 'AR', '72031', '(501) 745-2121', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (63, 'Animal Control & Shelters - De Queen Animal Control', '220 North 2nd Street', 'De Queen', 'AR', '71832', '(870) 642-2213', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (64, 'Union County Animal Protection Society', '1000 Sunset Road', 'El Dorado', 'AR', '71730', '(870) 862-0502', 'http://www.ucaps.netfirms.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (65, 'Good Shepherd Humane Society Shelter', '6486 Highway 62 West', 'Eureka Springs', 'AR', '72632', '(479) 253-9188', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (66, 'Fairfield Bay Animal Protection League', '350 Old Quarry Road', 'Fairfield Bay', 'AR', '72088', '(501) 884-6417', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (67, 'Fayetteville Animal Services', '1640 South Armstrong Avenue', 'Fayetteville', 'AR', '72701', '(479) 444-3456', 'http://www.accessfayetteville.org', '', '', '6 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Adoptions, Low Cost Spay/Neuter Program For Animals Of Low Income Individual, View Adoptable Pets At wwwfayettevilleanimalspetfindercom, For More Information About Services Go To... (Show More)\nPet Adoptions, Low Cost Spay/Neuter Program For Animals Of Low Income Individual, View Adoptable Pets At wwwfayettevilleanimalspetfindercom, For More Information About Services Go To wwwaccessfayettevilleorg  (Show Less)\n'); INSERT INTO `default_table` VALUES (68, 'Ozark Humane Society Shelter', '5147 Rock Springs Road', 'Harrison', 'AR', '72601', '(870) 741-3050', 'http://www.ozarkhumanesociety.com', 'info@ozarkhumanesociety.com', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (69, 'Madison County Pet Shelter', '2075 Madison 6555', 'Huntsville', 'AR', '72740', '(479) 738-1505', 'http://www.madisoncountypetshelter.petfinders.com', '', '', 'Tuesday-Saturday 9:00Am-2:00Pm,sunday-Monday Closed', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Adoptions, Community Funded Donations, All Pets Are Sprayed & Neutered Before Leaving Shelter\n'); INSERT INTO `default_table` VALUES (70, 'Jacksonville City - Ambulance, Communication & Dispatch, Fire Department, Police Department', '1100 Harris Road', 'Jacksonville', 'AR', '72076', '(501) 985-2802', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (71, 'Humane Society', '6111 Highland Drive', 'Jonesboro', 'AR', '72401', '(870) 932-5185', 'http://www.neahs.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt A Friend For Life, Help Homeless Dogs & Cats\n'); INSERT INTO `default_table` VALUES (72, 'Malvern-City - Animal Shelter', '2625 Canine Road', 'Malvern', 'AR', '72104', '(501) 332-7622', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (73, 'Icare-Izard County Animal Rescue Effort', '4449 Twin Creek', 'Melbourne', 'AR', '72556', '(870) 368-5000', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (74, 'For the Sake of Animals', '194 Peta Lane', 'Mena', 'AR', '71953', '(479) 394-1039', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (75, 'Paw Paws', '21213 Highway 18 East', 'Monette', 'AR', '72447', '(870) 486-5783', '', '', '', '', ''); INSERT INTO `default_table` VALUES (76, 'Sherwood-City - Animal Services', '6500 North Hills Boulevard', 'North Little Rock', 'AR', '72116', '(501) 834-2287', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (77, 'Sherwood-City Of', '6500 N Hills Boulevard', 'North Little Rock', 'AR', '72116', '(501) 834-2287', '', '', '', '', ''); INSERT INTO `default_table` VALUES (78, 'Oscela City Of Animal Shelter', '2501 West Semmes', 'Osceola', 'AR', '72370', '(870) 622-0739', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (79, 'Paws', '1103 East Kingshighway', 'Paragould', 'AR', '72450', '(870) 240-0997', '', '', '', '', ''); INSERT INTO `default_table` VALUES (80, 'Pine Bluff-City - Animal Shelter', '901 North Haverty Street', 'Pine Bluff', 'AR', '71601', '(870) 543-5135', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (81, 'Animal Control', '135 Landfill Road', 'Pocahontas', 'AR', '72455', '(870) 892-1390', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (82, 'Paws', '144 Lace Lane', 'Shirley', 'AR', '72153', '(501) 745-5684', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nHumane Societies\n'); INSERT INTO `default_table` VALUES (83, 'Texarkana Animal Shelter Inc', '203 Harrison Street', 'Texarkana', 'AR', '71854', '(870) 773-6388', '', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Additional Information:
\nCats & Dogs, Puppies & Kittens, For Adoption\n'); INSERT INTO `default_table` VALUES (84, 'Animal Shelter Assistance Program - ASAP', '5473 Overpass Rd', 'Goleta', 'CA', '93111', '(805) 683-3368', 'http://www.asapcats.org', 'asapcats@yahoo.com', '', '24 Hour Service', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nA Not - For - Profit Organization, Caring For Abandoned And Stray, Kittens & Cats At Your SB Animal Shelter\n'); INSERT INTO `default_table` VALUES (85, 'Horse Rescue Of America', '6021 Shannon Valley Road', 'Acton', 'CA', '93510', '(661) 269-5010', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (86, 'San Gabriel City - San Gabriel Valley Humane Society', '851 East Grand Avenue', 'Alhambra', 'CA', '91801', '(626) 286-1159', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (87, 'Conney Nancy', '19550 Hidden Glen Road', 'Alpine', 'CA', '91901', '(619) 445-6565', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (88, 'Redding Animal Regulation', '7449 Eastside Road', 'Anderson', 'CA', '96007', '(530) 241-2550', 'http://www.havenhumane.org', '', '', 'Friday, 8:30-5:00', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (89, 'Spay Neuter Clinic', '7449 Eastside Road', 'Anderson', 'CA', '96007', '(530) 241-1658', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nLow-Cost Spay-Neuter, Wellness Clinic, Medicine & Surgery, Cats & Dogs\n'); INSERT INTO `default_table` VALUES (90, 'Haven Humane Society', '7449 Eastside Road', 'Anderson', 'CA', '96007', '(530) 241-1658', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLow-Cost Spay-Neuter, Wellness Clinic, Medicine & Surgery, Cats & Dogs\n'); INSERT INTO `default_table` VALUES (91, 'Shelter Inc', '4553 Delta Fair Boulevard', 'Antioch', 'CA', '94509', '(925) 755-8595', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (92, 'Victor Valley Animal Protective League Inc', '21779 Zuni Road', 'Apple Valley', 'CA', '92307', '(760) 247-2102', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (93, 'Afar', '2300 Ramona Road', 'Atascadero', 'CA', '93422', '(805) 462-2327', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (94, 'Friends Of Auburn Placer Co Animal Shelter', '11251 B Avenue', 'Auburn', 'CA', '95603', '(530) 887-5520', '', '', '', '', ''); INSERT INTO `default_table` VALUES (95, 'Friends Of Auburn Placer Co Animal Shelter', '98 Gum Lane', 'Auburn', 'CA', '95603', '(530) 887-5500', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (96, 'Bakersfield SPCA - Pet Adoption Center', '3000 Gibson Street', 'Bakersfield', 'CA', '93308', '(661) 323-8353', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (97, 'Singh-Mahal Dheer Dvm-Animal & Bird Hospital Of Rosedale', '9339 Rosedale Highway', 'Bakersfield', 'CA', '93312', '(661) 589-1234', 'http://www.animalbirdvet.com', '', '', '24 Hours/ 7 Days', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n
Additional Information:
\nD Mahal DVM (Dr Singh, Compassionate & Quality Care At Affordable Prices, Internal Medicine & Surgery, Special Interest In, Dogs-Cats-Birds-Exotics, Spays/Neuters/Declaws, Discount Vaccinations,... (Show More)\nD Mahal DVM (Dr Singh, Compassionate & Quality Care At Affordable Prices, Internal Medicine & Surgery, Special Interest In, Dogs-Cats-Birds-Exotics, Spays/Neuters/Declaws, Discount Vaccinations, Wellness Plans Available, X-Ray, Ultrasound (On Call, In-House Lab, Microchip ID, Bone Surgery/Other Surgeries, Bird & Exotic Surgeries Also, English Bulldog Specialist, Bird Sex Determination, Climate Control Boarding, Skin Diseases & Flea Control, Artificial Insemination/C-Section, Early Drop Off - Late Pick Up, Emergency Care 24 Hours (On Call, For Clients Only  (Show Less)\n'); INSERT INTO `default_table` VALUES (98, 'Equine Excellence Nutrition Consultant', '211 Bell Canyon Road', 'Bell Canyon', 'CA', '91307', '(818) 888-0508', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (99, 'Human Society Inc', '7630 Eastern', 'Bell Gardens', 'CA', '90201', '(562) 927-0733', '', '', '', 'Open 7 Days a Week', '\nPayment Options:
\n\n
Additional Information:
\nSupercenter, Your Everyday Low Warehouse Pricing Leader, Wholesale Pricing, Coldest Beer, Largest Selection, Party Supplies\n'); INSERT INTO `default_table` VALUES (100, 'Banfield The Pet Hospital', '1001 Eastshore Highway', 'Berkeley', 'CA', '94710', '(510) 525-2674', 'http://www.banfield.net', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nComplete Medical & Surgical Services, Now Accepting New Clients, Convenient Hours Including Evenings And Weekends, Skin Care & Flea Control, Geriatrics & Cardiology, Spays/Neuters, Optimum Wellness... (Show More)\nComplete Medical & Surgical Services, Now Accepting New Clients, Convenient Hours Including Evenings And Weekends, Skin Care & Flea Control, Geriatrics & Cardiology, Spays/Neuters, Optimum Wellness Plans Available, 100% Vaccine Warranty, You Choose And K  (Show Less)\n'); INSERT INTO `default_table` VALUES (101, 'Berkeley-East Bay Humane Society', '2700 9th Street', 'Berkeley', 'CA', '94710', '(510) 845-3633', '', '', '', '', ''); INSERT INTO `default_table` VALUES (102, 'Scott Campbell Dvm & Associates', '1001 Eastshore Highway', 'Berkeley', 'CA', '94710', '(510) 525-2674', 'http://www.banfield.net', '', '', 'Open Evenings', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nTreating Your Pet Like Family, Complete Medical & Surgical Services, Now Accepting New Clients, Skin Care & Flea Control, Geriatrics & Cardiology, Spays/Neuters, Optimum Wellness Plans Available,... (Show More)\nTreating Your Pet Like Family, Complete Medical & Surgical Services, Now Accepting New Clients, Skin Care & Flea Control, Geriatrics & Cardiology, Spays/Neuters, Optimum Wellness Plans Available, 100% Vaccine Warranty, You Choose And Keep Your Pet''s Doct  (Show Less)\n'); INSERT INTO `default_table` VALUES (103, 'Berkley East Bay Humane Society', '2700 9th Street', 'Berkeley', 'CA', '94710', '(510) 845-7735', '', '', '', '', ''); INSERT INTO `default_table` VALUES (104, 'Amanda Foundation', '351 Foothill Road', 'Beverly Hills', 'CA', '90210', '(310) 278-2935', 'http://www.amanda-fnd.org', 'information@amanda-fnd.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (105, 'Find R Pet', '291 S La Cienega Boulevard', 'Beverly Hills', 'CA', '90211', '(310) 657-8935', '', '', '', '', ''); INSERT INTO `default_table` VALUES (106, 'Dog Cone Industries', '291 S La Cienega Boulevard', 'Beverly Hills', 'CA', '90211', '(310) 657-8934', '', '', '', '', ''); INSERT INTO `default_table` VALUES (107, 'Plumas Wildlife Care', '276 Main', 'Blairsden-Graeagle', 'CA', '96103', '(530) 836-4432', '', '', '', '', ''); INSERT INTO `default_table` VALUES (108, 'Chanslor Wetlands Wildlife Project', '2660 North Highway 1', 'Bodega Bay', 'CA', '94923', '(707) 875-3490', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (109, 'Santa Ynez Valley Humane Society', '111 Commerce Drive PO Box 335', 'Buellton', 'CA', '93427', '(805) 688-8224', 'http://www.syvhumane.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (110, 'Boulevard Pet Hospital', '1555 South Winchester Boulevard', 'Campbell', 'CA', '95008', '(408) 379-5554', '', '', '', 'Open Evenings', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nDentistry Boarding, Animal Maintenance Supplies, Microchip Identification - Toy Breed Rescue\n'); INSERT INTO `default_table` VALUES (111, 'Donations For Homeless And Abuse Animals', '7530 Deering Avenue', 'Canoga Park', 'CA', '91303', '(818) 610-7466', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (112, 'Canyon Lake City - Animal Control', '31532 Railroad Canyon Road', 'Canyon Lake', 'CA', '92587', '(951) 674-0618', '', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Additional Information:
\nShelter For Tape Information, LAKE ELSINORE, CANYON LAKE, MURRIETA & TEMECULA ANIMAL, CONTROL, All Owner, City & Surrounding County, Mon-Sat 10-4\n'); INSERT INTO `default_table` VALUES (113, 'San Diego County - Animal Control Department, North Shelter', '2481 Palomar Airport Road', 'Carlsbad', 'CA', '92011', '(760) 438-2312', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (114, 'Golden West Livestock Products', '1812 East Whitmore Avenue Suite D', 'Ceres', 'CA', '95307', '(209) 541-1952', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (115, 'Benevolent Animal Rescue Committee (BARC)', '39867 High St', 'Cherry Valley', 'CA', '92223', '(909) 389-9552', 'http://www.barconline.com', 'info@barconline.com', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nSpay And Neuter Foundation, Donations Welcome, Proceeds Support, Spaying & Neutering & Rescue Of Local Animals\n'); INSERT INTO `default_table` VALUES (116, 'Butte Humane Society', '2579 Fair Street', 'Chico', 'CA', '95928', '(530) 343-7917', 'http://www.buttehumane.org', '', '', 'Monday-Tuesday 12:00Pm-6:00Pm,wednesday 12:00Pm-7:00Pm,thursday-Saturday 12:00Pm-6:00Pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\n~Host To Some Of The Best Friends You''ll Ever Know~, Adopt And Animal Today\n'); INSERT INTO `default_table` VALUES (117, 'Casl Industries', '145 Mount Everest Court', 'Clayton', 'CA', '94517', '(925) 685-6055', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (118, 'Claws Spay-Neuter', '14106 Olympic Drive', 'Clearlake', 'CA', '95422', '(707) 994-3499', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (119, 'Claws Spay-Neuter', '14106 Olympic Drive', 'Clearlake', 'CA', '95422', '(707) 994-9505', '', '', '', '', '\nAdditional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (120, 'Fresno Wildlife Rehabilitation Service', '55 Temperance Avenue', 'Clovis', 'CA', '93611', '(559) 325-2888', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (121, 'Tenth Life For Cats And Critters', '2397 Charlotte Avenue', 'Concord', 'CA', '94518', '(925) 798-8522', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (122, 'Shelter Inc', '2047 Arnold Industrial Wa', 'Concord', 'CA', '94520', '(925) 686-1116', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (123, 'Furry Friends Pet Center', '1390 West 6th Street', 'Corona', 'CA', '92882', '(951) 278-8817', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (124, 'Los Angeles County - Animal Care & Control, Animal Center No 4, Animal Control-Pickup', '4275 Elton Baldwin Park', 'Covina', 'CA', '91722', '(626) 962-3577', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (125, 'Assistance League Of Covina Valley', '636 East San Bernardino Road', 'Covina', 'CA', '91723', '(626) 966-7550', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nThrift Stores\n'); INSERT INTO `default_table` VALUES (126, 'Dave''s Breeding Service', '4205 Greenview Drive', 'Denair', 'CA', '95316', '(209) 632-4858', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (127, 'Save A Pet', '67600 18th Avenue', 'Desert Hot Springs', 'CA', '92241', '(760) 329-8510', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (128, 'Southeast Area Animal Control Authority', '9777 Seaaca Street', 'Downey', 'CA', '90241', '(562) 803-3301', 'http://www.seaaca.org', '', 'Low Cost Spay, Neuter, Vaccinations, Pet Adoptions.', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (129, 'Tri Valley Spca', '4651 Gleason Drive', 'Dublin', 'CA', '94568', '(925) 479-9670', 'http://www.eastbayspca.org', '', '', 'Weekdays Through Sunday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDog Training, Puppy - Basic - Advanced, Agility - Small Dog Classes, Weekends - Evenings - Private\n'); INSERT INTO `default_table` VALUES (130, 'Friends of Cats Inc', '15587 Olde Highway 80', 'El Cajon', 'CA', '92021', '(619) 561-0361', 'http://friendsofcats.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (131, 'San Diego Turtle & Tortoise Society', '560 Robinson Avenue', 'El Cajon', 'CA', '92019', '(619) 593-2123', 'http://www.sdturtle.org', '', '', '10 Am To 5 Pm Sat 10 Am To 4 Pm Sun.', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (132, 'Humane Society Of Imperial Valley', '1575 West Pico Avenue', 'El Centro', 'CA', '92243', '(760) 352-1911', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (133, 'Wildlife Rescue - Sierra Wildlife Rescue', '6236 Main', 'El Dorado', 'CA', '95623', '(530) 621-4661', 'http://www.sierrawildliferescue.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nRescue / Rehab, For Orphaned Or Injured, Wild Animals Or Birds\n'); INSERT INTO `default_table` VALUES (134, 'Noah''s Wish', '5047 Robert J Mathews Pkw', 'El Dorado Hills', 'CA', '95762', '(916) 939-9479', '', '', '', '', ''); INSERT INTO `default_table` VALUES (135, 'Emergency Pet Clinic Of San Gabriel Valley', '3254 Santa Anita Avenue', 'El Monte', 'CA', '91733', '(626) 579-4550', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nEmergencies, Open Holidays 24 Hours, Please Call Before Coming, Member AHA\n'); INSERT INTO `default_table` VALUES (136, 'Animal Advocacy & Relief Foundation', '17328 Ventura Boulevard', 'Encino', 'CA', '91316', '(818) 994-8138', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (137, 'Pooch Heaven', '17328 Ventura Boulevard', 'Encino', 'CA', '91316', '(818) 994-8138', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (138, 'Groppetti Breeding Service', '1010 1st Street', 'Escalon', 'CA', '95320', '(209) 838-2520', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (139, 'Cathy''s Canine', '2205 East Valley Parkway', 'Escondido', 'CA', '92027', '(760) 745-1700', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nAll Breed Dog And Cat Grooming, Hydro Surge Therapeutic Bathing, Wide Variety Of Specialty Shampoos, Flea And Tick Control, Family Owned And Operated, Walk-Ins Welcome 8 AM-11AM\n'); INSERT INTO `default_table` VALUES (140, 'Dale Baker Hoof Trimming Inc', '20128 Avenue 312', 'Exeter', 'CA', '93221', '(559) 594-9583', '', '', '', '', '\nAdditional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (141, 'Fairfield City - City Hall, Animal Control-Humane Animal Services', '1000 Webster Street', 'Fairfield', 'CA', '94533', '(707) 449-1700', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (142, 'International Bird Rescue Research Center', '4369 Cordelia Road', 'Fairfield', 'CA', '94534', '(707) 207-0380', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (143, 'Fallbrook Animal Lodge', '1115 East Mission Road', 'Fallbrook', 'CA', '92028', '(760) 728-0892', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (144, 'Phyllis Encouragement Factor', '425 East Alvarado Street Suite B', 'Fallbrook', 'CA', '92028', '(760) 731-3037', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (145, 'BARC', '16376 Jurupa Avenue', 'Fontana', 'CA', '92337', '(909) 355-7387', 'http://www.barcpetrescue.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSafe & Caring, Pet Boarding & Grooming, Pet Adoption, Low Cost Spay/Neuter Information, Serving San Bernardino & Riverside Counties\n'); INSERT INTO `default_table` VALUES (146, 'Becker Carol A Animal Communicator', '16651 Franklin Road', 'Fort Bragg', 'CA', '95437', '(707) 964-4442', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (147, 'Mendocino Coast Humane Society', '19691 Summers Lane', 'Fort Bragg', 'CA', '95437', '(707) 964-7729', '', 'info@mendocinohumane.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (148, 'All Paws On Board', '18918 Brookhrst', 'Fountain Valley', 'CA', '92708', '(714) 964-9304', 'http://www.allpawsonboard.com', 'suschu@verizon.net', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Brands:
\n\n
Languages Spoken:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nDay Care For Dogs, Constant Supervision, Air-Conditioned & Air-Purified, Large Indoor Play Area, Rubber Matted Floor For Safety, Indoor ~Poop Deck~ With Real Grass, Variety Of Dog Food Products... (Show More)\nDay Care For Dogs, Constant Supervision, Air-Conditioned & Air-Purified, Large Indoor Play Area, Rubber Matted Floor For Safety, Indoor ~Poop Deck~ With Real Grass, Variety Of Dog Food Products Including Natural Balance, Boarding For Dogs And Cats, On Call Veterinary Services, ~Where Small Dogs Rule~, Free Evaluation By Appo  (Show Less)\n'); INSERT INTO `default_table` VALUES (149, 'Humane Society', '103 South Hughes Avenue', 'Fresno', 'CA', '93706', '(559) 233-7722', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Control\n'); INSERT INTO `default_table` VALUES (150, 'Society For The Prevention Of Cruelty To Animals', '103 South Hughes Avenue', 'Fresno', 'CA', '93706', '(559) 233-7722', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (151, 'Central California SPCA', '103 South Hughes Avenue', 'Fresno', 'CA', '93706', '(559) 233-7722', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Control\n'); INSERT INTO `default_table` VALUES (152, 'California Feline Foundation', '550 North Van Ness Avenue', 'Fresno', 'CA', '93728', '(559) 233-8554', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (153, 'Animal Rescue Of Fresno Pet Adoption Center', '2634 W Belmont Avenue', 'Fresno', 'CA', '93728', '(559) 498-8640', '', '', '', '', ''); INSERT INTO `default_table` VALUES (154, 'Animal Shelter Assistance Program - ASAP', '5473 Overpass Rd', 'Goleta', 'CA', '93111', '(805) 683-3368', 'http://www.asapcats.org', 'asapcats@yahoo.com', '', '24 Hour Service', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nA Not - For - Profit Organization, Caring For Abandoned And Stray, Kittens & Cats At Your SB Animal Shelter\n'); INSERT INTO `default_table` VALUES (155, 'Animal Shelter & Control', '556 Freeman Lane', 'Grass Valley', 'CA', '95949', '(530) 477-4630', '', '', '', 'Open 24 Hours a Day', '\nProducts & Services:
\n\n
Additional Information:
\nAvoid Jail, Drugs, Theft, Assault, Molest, Juvenile, Sex Crimes, Drunk Drive, Domestic Vio, Embezzlement, Jail Alternatives\n'); INSERT INTO `default_table` VALUES (156, 'Another Life for Animals', '225 Cabrillo Highway South', 'Half Moon Bay', 'CA', '94019', '(650) 726-2029', 'http://www.anotherlifeforanimals.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (157, 'Kings Spca', '8084 Lacey Boulevard', 'Hanford', 'CA', '93230', '(559) 584-8766', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSHELTER, SPAY & NEUTER CLINIC, PLACEMENT SERVICE FOR ANIMALS\n'); INSERT INTO `default_table` VALUES (158, 'SPCA Hawthorne', '12910 Yukon Avenue', 'Hawthorne', 'CA', '90250', '(310) 644-7739', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (159, 'Spca-La South Bay Pet Adoption', '12910 Yukon Avenue', 'Hawthorne', 'CA', '90250', '(310) 676-1149', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (160, 'Society For The Prevention Of Cruelty To Animals Los Angeles', '12910 Yukon Avenue', 'Hawthorne', 'CA', '90250', '(310) 676-1149', 'http://www.spcala.com', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (161, 'Healdsburg City - Animal Shelter', '570 Westside Road', 'Healdsburg', 'CA', '95448', '(707) 431-3386', 'http://www.healdsburgshelter.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nLicenses, Community Services, May I Help, Senior Citizens Services, See Senior Services In The Yellow Pages\n'); INSERT INTO `default_table` VALUES (162, 'DC Creature sitter', '10944 chelsea st.', 'Hesperia', 'CA', '92345', '(760) 956-6435', '', 'crayelad@aol.com', '', '', '\nPayment Options:
\n\n'); INSERT INTO `default_table` VALUES (163, 'Pet Friends-An Animal Adoption Organization', '2975 Buena Vista Road', 'Hollister', 'CA', '95023', '(831) 634-1191', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (164, 'Bear League Wildlife Education', '4875 West Lake Boulevard', 'Homewood', 'CA', '96141', '(530) 525-7297', 'http://www.savebears.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (165, 'Aaa Animal Hospital', '21632 Newland Street', 'Huntington Beach', 'CA', '92646', '(714) 536-6537', 'http://www.aaaveterinarygroup.com/nohlranchanimalhospital/', '', 'A Full Service Facility', 'M-F 9am-5:30pm / Sat 10:00am-12pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nL. Rosenberg, D.V.M., N. AZIZ, D.V.M.\n'); INSERT INTO `default_table` VALUES (166, 'Nasre Nabil Dvm', '21632 Newland Street', 'Huntington Beach', 'CA', '92646', '(714) 536-6537', '', '', '', 'Sat. 8-1
Till 10pm Monday-friday
Thursdays 7pm-9pm', '\nProducts & Services:
\n\n
Additional Information:
\nL. Rosenberg, D.V.M., N. AZIZ, D.V.M.\n'); INSERT INTO `default_table` VALUES (167, 'Orange County Humane Society', '21632 Newland Street', 'Huntington Beach', 'CA', '92646', '(714) 536-6537', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nL. Rosenberg, D.V.M., N. AZIZ, D.V.M.\n'); INSERT INTO `default_table` VALUES (168, 'Aaa Animal Hospital', '21632 Newland Street', 'Huntington Beach', 'CA', '92646', '(714) 536-8480', 'http://www.aaaveterinarygroup.com/nohlranchanimalhospital/', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nFor Low Cost Vet Care, Spay & Vaccination-714-536-6537, Animal Adoption-Placement\n'); INSERT INTO `default_table` VALUES (169, 'Orange County Humane Society', '21632 Newland Street', 'Huntington Beach', 'CA', '92646', '(714) 536-8480', 'http://www.ochumanesociety.com', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nL. Rosenberg, D.V.M., N. AZIZ, D.V.M.\n'); INSERT INTO `default_table` VALUES (170, 'Animal Shelter', '4646 Sunview Avenue', 'Joshua Tree', 'CA', '92252', '(760) 366-3786', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (171, 'Morongo Basin Humane Society', '4646 Sunview Avenue', 'Joshua Tree', 'CA', '92252', '(760) 366-3786', '', '', '', '', ''); INSERT INTO `default_table` VALUES (172, 'Spca Of Clear Lake - Low Cost Spay Clinic-Animal Shelter', '8025 Highway 29', 'Kelseyville', 'CA', '95451', '(707) 279-1400', 'http://www.spcaofclearlake.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLow Cost Spay & Neuter Clinic Vaccinations\n'); INSERT INTO `default_table` VALUES (173, 'Spca Of Clear Lake', '8025 Highway 29', 'Kelseyville', 'CA', '95451', '(707) 995-2273', 'http://www.spcaofclearlake.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLow Cost, Spay & Neuter Clinic\n'); INSERT INTO `default_table` VALUES (174, 'Laguna Beach Animal Shelter', '20612 Laguna Canyon Road', 'Laguna Beach', 'CA', '92651', '(949) 497-3552', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (175, 'San Diego Animal Rescue', '11851 Northill Terrace', 'Lakeside', 'CA', '92040', '(619) 390-7585', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (176, 'Animal Friends of the Valleys', '29001 Bastrn Avenue', 'Lake Elsinore', 'CA', '92530', '(951) 674-0618', '', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nShelter For Tape Information, LAKE ELSINORE, CANYON LAKE, MURRIETA & TEMECULA ANIMAL, CONTROL, All Owner, City & Surrounding County, Mon-Sat 10-4\n'); INSERT INTO `default_table` VALUES (177, 'Lake Isabella Animal Shelter', '14891 Highway 178', 'Lake Isabella', 'CA', '93240', '(760) 378-1131', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (178, 'Lifesavers Wild Horse', '23809 East Avenue J', 'Lancaster', 'CA', '93535', '(661) 727-0049', 'http://www.wildhorserescue.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (179, 'P A S S', '148 South 8th Ave', 'La Puente', 'CA', '91746', '(626) 961-6284', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nTicket Sales-Entertainment & Sports\n'); INSERT INTO `default_table` VALUES (180, 'Golden Retriever Rescue', '40064 West 107th Street', 'Leona Valley', 'CA', '93551', '(661) 270-0570', '', '', '', '', ''); INSERT INTO `default_table` VALUES (181, 'Fieldhaven Feline Rescue', '2754 Ironwood Lane', 'Lincoln', 'CA', '95648', '(916) 434-6022', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (182, 'Lindsay Animal Control', '23611 Road 196', 'Lindsay', 'CA', '93247', '(559) 562-6577', '', '', '', 'Tues,sat 3Pm-6Pm,wed 3Pm-7Pm,closed Sun-Mon', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPREVENT PET, OVERPOPULATION, SPAY & NEUTER YOUR PETS, ADOPTION AVAILABLE\n'); INSERT INTO `default_table` VALUES (183, 'Animal Friends Connection Humane Society', '933 South Cherokee Lane', 'Lodi', 'CA', '95240', '(209) 365-0535', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (184, 'Humane Society Hotline', '933 South Cherokee Lane', 'Lodi', 'CA', '95240', '(209) 368-1761', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (185, 'People Assisting Lodi Shelter', '1710 West Sargent Road', 'Lodi', 'CA', '95240', '(209) 366-2102', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (186, 'Animal Shelter Lompoc', '1501 West Central Avenue', 'Lompoc', 'CA', '93436', '(805) 737-7755', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (187, 'New Image Emergency Shelter', '401 E Ocean Boulevard', 'Long Beach', 'CA', '90802', '(562) 983-7289', '', '', '', '', ''); INSERT INTO `default_table` VALUES (188, 'National Cat Protection Society', '1528 West 17th Street', 'Long Beach', 'CA', '90813', '(562) 436-3162', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (189, 'Animal Training and Husbandry School', '4103 Holly Knoll Drive', 'Los Angeles', 'CA', '90027', '(323) 665-9500', '', '', '', '', ''); INSERT INTO `default_table` VALUES (190, 'Paws L A', '1546 Argyle Avenue', 'Los Angeles', 'CA', '90028', '(323) 464-7297', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (191, 'Melrose Pet Grooming', '5770 Melrose Avenue Suite 102', 'Los Angeles', 'CA', '90038', '(323) 993-1959', '', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nI Love Being Groomed By Mina, Complete Grooming All Breeds & Sizes, Service Includes, Quality Shampoo Cream Rinse/Fluff Dry, Flea Dip & Skin Care, Toe Nail Trim / Ears Cleaned, Anal Glands... (Show More)\nI Love Being Groomed By Mina, Complete Grooming All Breeds & Sizes, Service Includes, Quality Shampoo Cream Rinse/Fluff Dry, Flea Dip & Skin Care, Toe Nail Trim / Ears Cleaned, Anal Glands Expressed, Medicated Shampoo If Needed, Free Day Care - Dogs & Cats, Licensed Stylist (Mina)  (Show Less)\n'); INSERT INTO `default_table` VALUES (192, 'PETA', '2898 Rowena Avenue', 'Los Angeles', 'CA', '90039', '(323) 644-7382', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (193, 'Society For Prevention Of Cruelty To Animals-Los Angeles', '5026 West Jefferson Boulevard', 'Los Angeles', 'CA', '90016', '(323) 730-5300', 'http://www.spcala.com', '', '', 'Tuesday 7:30-8:30 P.m.', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (194, 'Chrisco Apartments', '1382 Kelton Avenue', 'Los Angeles', 'CA', '90024', '(310) 473-0369', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (195, 'Lange Foundation', '2106 South Sepulveda Boulevard', 'Los Angeles', 'CA', '90025', '(310) 473-5585', 'http://www.langefoundation.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (196, 'Salvation Army Westwood Village', '1401 S Sepulveda Boulevard', 'Los Angeles', 'CA', '90025', '(310) 477-9539', '', '', '', '', ''); INSERT INTO `default_table` VALUES (197, 'Pet Pride Cat Shelter', '3350 South Robertson Boulevard', 'Los Angeles', 'CA', '90034', '(310) 836-5427', 'http://www.petpride.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (198, 'Ray Of Hope Inc', '1065 E Yosemite Avenue', 'Manteca', 'CA', '95336', '(209) 825-6309', '', '', '', '', ''); INSERT INTO `default_table` VALUES (199, 'Manteca City - Police Department, Animal Shelter', '208 East Wetmore Street', 'Manteca', 'CA', '95337', '(209) 239-8480', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (200, 'BARC Thrift & Gift', '1862 Mentone Boulevard', 'Mentone', 'CA', '92359', '(909) 389-9552', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (201, 'SPCA Adoption Center', '1021 East Childs Avenue', 'Merced', 'CA', '95340', '(209) 384-7722', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (202, 'Spca Of Monterey County-Humane Society', '1002 Salinas Highway', 'Monterey', 'CA', '93940', '(831) 422-4721', 'http://www.spcamc.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nAn Independent Donor-Supported Humane Society, Serving The Community Since 1905, Companion Animals For Adoption, Pet Adoption Center Ext 233 Or 234, Low Cost Spay/Neuter Clinic Ext 218, Humane... (Show More)\nAn Independent Donor-Supported Humane Society, Serving The Community Since 1905, Companion Animals For Adoption, Pet Adoption Center Ext 233 Or 234, Low Cost Spay/Neuter Clinic Ext 218, Humane Investigations Ext 213, Wildlife Rescue Ext 227, Volunteer Opportunities Ext 223  (Show Less)\n'); INSERT INTO `default_table` VALUES (203, 'Spca Of Monterey County-Humane Society', '1002 Salinas Highway', 'Monterey', 'CA', '93940', '(831) 373-2631', 'http://www.spcamc.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nA Local Donor-Supported Humane Society Serving The Community Since 1905, Adoptions/Viewing\n'); INSERT INTO `default_table` VALUES (204, 'Animal', '48981 Oregon Trail', 'Morongo Valley', 'CA', '92256', '(760) 363-6511', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (205, 'Marine Mammal Center', '200 Dolan Road', 'Moss Landing', 'CA', '95039', '(831) 633-6298', 'http://www.marinemammalcenter.org', '', '', '24 Hours A Day', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (206, 'Living Free Animal Sanctuary', '54250 Keen Camp Road', 'Mountain Center', 'CA', '92561', '(951) 659-4684', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (207, 'Siskiyou Humane Society Adoption Center', '1208 North Mount Shasta Boulevard', 'Mount Shasta', 'CA', '96067', '(530) 926-4052', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (208, 'Animal Shelter', '942 Imola Avenue West', 'Napa', 'CA', '94558', '(707) 253-4848', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPet Shops, Animal Shelters\n'); INSERT INTO `default_table` VALUES (209, 'Napa County - Environmental Management, Animal Shelter', '942 Hartle Avenue', 'Napa', 'CA', '94559', '(707) 253-4381', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nAmerica''s Auto Parts Pipeline, Machine Shop, Drums & Rotors Turned, Press Work, Flywheel Grinding, Valve Jobs & Engines, Our Knowledgeable Trained Staff Provides You With Personalized Service, 3... (Show More)\nAmerica''s Auto Parts Pipeline, Machine Shop, Drums & Rotors Turned, Press Work, Flywheel Grinding, Valve Jobs & Engines, Our Knowledgeable Trained Staff Provides You With Personalized Service, 3 Locations To Serve You  (Show Less)\n'); INSERT INTO `default_table` VALUES (210, 'National Cat Protection Society', '6904 West Coast Highway', 'Newport Beach', 'CA', '92663', '(949) 650-1232', 'http://www.natcat.org', 'natcat04@earthlink.net', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nA Non-Profit Organization, NATCAT, Adoptions & Placement Services Retirement Center, Adorable Cats & Kittens, Mixed & Purebreds, Leukemia Tested, Donations Are Vita To Our Existence\n'); INSERT INTO `default_table` VALUES (211, 'C M W Nutrition', '2671 Preakness Way', 'Norco', 'CA', '92860', '(951) 278-4202', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (212, 'Pot Belly Pig Rescue', '19025 Parthenia Street', 'Northridge', 'CA', '91324', '(818) 701-1534', 'http://www.jojoba-ksa.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (213, 'K S A Hohoba', '19025 Parthenia Street', 'Northridge', 'CA', '91324', '(818) 701-1534', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (214, 'Crossroads Animals', '11057 Rosecrans Avenue', 'Norwalk', 'CA', '90650', '(562) 863-5562', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (215, 'Animal Outfitters', '171 Bel Marin Keys Boulevard', 'Novato', 'CA', '94949', '(415) 883-4621', 'http://www.marinhumanesociety.org', '', '', '24 Hour Emergency Service', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nRescue Rehabilitate & Rehome, 24 Hour Emergency Rescue X 1, Adoptions X225, Donations X257, Education X288, Lost Dogs/Cats X377/x378, Monthly Shot Clinics X262, Pet Supplies X229, Behavior &... (Show More)\nRescue Rehabilitate & Rehome, 24 Hour Emergency Rescue X 1, Adoptions X225, Donations X257, Education X288, Lost Dogs/Cats X377/x378, Monthly Shot Clinics X262, Pet Supplies X229, Behavior & Training X280  (Show Less)\n'); INSERT INTO `default_table` VALUES (216, 'Marin Humane Society - Lost Animals Recording', '171 Bel Marin Keys Boulevard', 'Novato', 'CA', '94949', '(415) 883-4621', 'http://www.marinhumanesociety.org', '', '', '24 Hour Service', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nRescue Rehabilitate & Rehome, 24 Hour Emergency Rescue X 1, Adoptions X225, Donations X257, Education X288, Lost Dogs/Cats X377/x378, Monthly Shot Clinics X262, Pet Supplies X229, Behavior &... (Show More)\nRescue Rehabilitate & Rehome, 24 Hour Emergency Rescue X 1, Adoptions X225, Donations X257, Education X288, Lost Dogs/Cats X377/x378, Monthly Shot Clinics X262, Pet Supplies X229, Behavior & Training X280  (Show Less)\n'); INSERT INTO `default_table` VALUES (217, 'Marin Humane Society', '171 Bel Marin Keys Boulevard', 'Novato', 'CA', '94949', '(415) 506-6267', '', '', '', '', ''); INSERT INTO `default_table` VALUES (218, 'Marin Humane Society', '171 Bel Marin Keys Boulevard', 'Novato', 'CA', '94949', '(415) 506-6280', '', '', '', '', ''); INSERT INTO `default_table` VALUES (219, 'Oakland SPCA A Facility of the East Bay SPCA', '8323 Baldwin Street', 'Oakland', 'CA', '94621', '(510) 569-2591', 'http://www.oaklandspca.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (220, 'Oakland SPCA Dog Training', '8323 Baldwin Street', 'Oakland', 'CA', '94621', '(510) 569-0702', 'http://www.eastbayspca.org', '', '', 'Weekend & Evening Classes', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSPCA Dog Training Promotes Socializing Skills And Ensures Better Communication Between Pets And Owners, Puppy Kindergarten, Puppy Management, Private Drop-In Weekend & Evening Classes, Call For... (Show More)\nSPCA Dog Training Promotes Socializing Skills And Ensures Better Communication Between Pets And Owners, Puppy Kindergarten, Puppy Management, Private Drop-In Weekend & Evening Classes, Call For Class Schedules At Our Two Locations, Enroll Online At wwweastbayspcaorg, Saving Lives In The East Bay For Ov  (Show Less)\n'); INSERT INTO `default_table` VALUES (221, 'East Bay S P C A Main Office Adoption Center', '410 Hegenberger', 'Oakland', 'CA', '94621', '(510) 569-0702', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (222, 'Hopalong Animal Rescue', '160 Franklin Street', 'Oakland', 'CA', '94601', '(510) 267-1915', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (223, 'North County Humane Society and SPCA', '2905 San Luis Rey Road', 'Oceanside', 'CA', '92054', '(760) 757-4357', 'http://www.nchumane.org', '', '', 'Monday-Sunday 10:00Am-5:00Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (224, 'Humane Society of Ventura County', '402 South Ventura Street', 'Ojai', 'CA', '93023', '(805) 656-5031', 'http://www.humanesocietyvc.org', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nHumane Society Of Ventura, Low-Cost Spay, Neuter Clinic, Immediate appointments, Quality surgical care, Low-cost immunizations\n'); INSERT INTO `default_table` VALUES (225, 'Humane Society Of Ventura County - Animal Shelter', '402 Bryant Street', 'Ojai', 'CA', '93023', '(805) 646-6505', 'http://www.humanesocietyvc.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (226, 'Humane Society Of Ventura County', '402 Bryant Street', 'Ojai', 'CA', '93023', '(805) 656-5031', 'http://www.humanesocietyvc.org', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLow-Cost Spay And Neuter Clinic, Serving The Animals And People Of Ventura County Since 1932, Immediate Appointments, Quality Surgical Care, Low-Cost Immunizations\n'); INSERT INTO `default_table` VALUES (227, 'West End Shelter for Animals', '1010 East Mission Boulevard', 'Ontario', 'CA', '91761', '(909) 947-3517', 'http://www.westendanimalshelter.petfinder.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (228, 'Nohl Ranch Animal Hospital', '735 East Lincoln Avenue', 'Orange', 'CA', '92865', '(714) 536-6537', '', '', '', 'Monday-Friday 7:30Am-6:30Pm,saturday-Sunday 8:00Am-5:00Pm,open 7 Days A Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (229, 'Animal Assistance League Of Orange County Inc', '561 The City Drive South', 'Orange', 'CA', '92868', '(714) 978-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (230, 'Noah''s Friends Animal Sanctuary', '5228 South Anchor Avenue', 'Orange Cove', 'CA', '93646', '(559) 626-0738', 'http://www.noahandfriends.homestead.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (231, 'Paws Place Thrift & Gifts', '2100 Myers Street', 'Oroville', 'CA', '95966', '(530) 534-5713', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (232, 'Northwest S P C A', '2868 South 5th Avenue', 'Oroville', 'CA', '95965', '(530) 533-7636', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (233, 'Animal Control - Northwest, SPCA', '2868 South 5th Avenue', 'Oroville', 'CA', '95965', '(530) 533-7636', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nCommunity Services, May I Help, Licenses\n'); INSERT INTO `default_table` VALUES (234, 'Police Department - Oroville City, Neighborhood Community, Policing Officers, Animal Enforcement', '2055 Lincoln Street', 'Oroville', 'CA', '95965', '(530) 533-7636', '', '', '', '', ''); INSERT INTO `default_table` VALUES (235, 'Wildlife Rehabilitation Center', '3175 Panoche Road', 'Paicines', 'CA', '95043', '(831) 628-3400', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (236, 'CVSPCA', '75150 Saint Charles Place', 'Palm Desert', 'CA', '92211', '(760) 346-2226', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (237, 'At Home Pet Care', '37310 Wyndham Rd.', 'Palm Desert', 'CA', '92211', '(760) 360-8236', '', '', 'A Homely Alternative To Kennels', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nContact Us If Vacationing Or In The Area! Hours By Appointment Only!\n'); INSERT INTO `default_table` VALUES (238, 'Wildlife Rescue Inc', '4000 Middlefield Road', 'Palo Alto', 'CA', '94303', '(650) 494-7283', 'http://www.wildliferescue.ws', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (239, 'Pasadena Humane Society', '361 South Raymond Avenue', 'Pasadena', 'CA', '91105', '(626) 792-7151', 'http://www.phsspca.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (240, 'Pixelworks Digital Color Laboratory', '70 East Washington Street', 'Petaluma', 'CA', '94952', '(707) 762-1000', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (241, 'Petaluma City - Animal Service, Shelter', '840 Hopper Street', 'Petaluma', 'CA', '94952', '(707) 778-4396', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nLicenses, Community Services, May I Help, Senior Citizens Services, See Senior Services In The Yellow Pages\n'); INSERT INTO `default_table` VALUES (242, 'Animal Legal Defense Fund', '127 4th Street', 'Petaluma', 'CA', '94952', '(707) 769-7771', '', '', '', '', ''); INSERT INTO `default_table` VALUES (243, 'Valley Humane Society', '273 Spring Street', 'Pleasanton', 'CA', '94566', '(925) 426-8656', 'http://www.valleyhumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (244, 'Dogs and Cats Latino Rescue', '685 W. Mission Blvd.E', 'Pomona', 'CA', '91766', '(909) 620-7771', 'http://dogsandcatslatinorescue.org', 'dogsandcatslatinorescue@yahoo.com', '', 'Mon-Fri: 08:00 AM-07:30 PM', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nWe are a non-profit dog and cat rescue org. that formed to rescue and adopt-out to good homes as many as possible strays and surrendered cats and dogs\n'); INSERT INTO `default_table` VALUES (245, 'Inland Valley Humane Society', '500 Humane Way', 'Pomona', 'CA', '91766', '(909) 623-9777', 'http://www.ivhsspca.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (246, 'High Sierra Animal Rescue', '103 Meadow Ridge Lane', 'Portola', 'CA', '96122', '(530) 832-4727', 'http://www.highsierraanimalrescue.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (247, 'Paws', '2453 East Main Street', 'Quincy', 'CA', '95971', '(530) 283-5433', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (248, 'Plumas County - Animal Shelter', '201 North Mill Creek Road', 'Quincy', 'CA', '95971', '(530) 283-3673', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (249, 'Helen Woodward Animal Center', '6461 El Apajo Road', 'Rancho Santa Fe', 'CA', '92067', '(858) 756-4117', 'http://www.animalcenter.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPuppies Kittens Dogs & Cats, Come And See Our Fabulous Selection Of Cute And Cuddly Pets, Adopt Today, Receive Free With Adoption, Pre-Adoption Vaccinations, Spay/Neuter, Microchip & More, Education... (Show More)\nPuppies Kittens Dogs & Cats, Come And See Our Fabulous Selection Of Cute And Cuddly Pets, Adopt Today, Receive Free With Adoption, Pre-Adoption Vaccinations, Spay/Neuter, Microchip & More, Education Department X 318, Critter Camp, Scouting Programs, First Friends, Dog Smart, AniMobile, 5-Star Boarding Facility  (Show Less)\n'); INSERT INTO `default_table` VALUES (250, 'Pets in Need', '873 5th Avenue', 'Redwood City', 'CA', '94063', '(650) 367-1405', 'http://www.petsinneed.org', 'info@petsinneed.org', '', '', '\nProducts & Services:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nDog Obedience Training, Beginner, Intermediate, Advanced, Puppy Classes Also Available Starting At 4 Months, Canine College\n'); INSERT INTO `default_table` VALUES (251, 'Humane Society for Inland Mendocino County', '9700 Uva Drive', 'Redwood Valley', 'CA', '95470', '(707) 485-0123', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (252, 'Ridgecrest Animal Control', '411 San Bernardino Boulevard', 'Ridgecrest', 'CA', '93555', '(760) 499-5190', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (253, 'Kern Co Animal Control', '411 San Bernardino Boulevard', 'Ridgecrest', 'CA', '93555', '(760) 375-3446', '', '', '', '', ''); INSERT INTO `default_table` VALUES (254, 'Waggin Tails', '3035 Chicago', 'Riverside', 'CA', '92507', '(951) 321-4135', '', '', '', '', ''); INSERT INTO `default_table` VALUES (255, 'Riverside Humane Society Pet Adoption Center', '5791 Fremont Street', 'Riverside', 'CA', '92504', '(951) 688-4340', '', 'rhs@petsadoption.com', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (256, 'Pedley Vet Tack & Feed Supply', '8978 Limonite Avenue', 'Riverside', 'CA', '92509', '(951) 685-3511', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (257, 'Forgotten Felines Of Sonoma', '301 J Rogers Lane', 'Rohnert Park', 'CA', '94928', '(707) 584-4998', 'http://www.forgottenfelines.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (258, 'Rohnert Park Animal Shelter', '301 J Rogers Lane', 'Rohnert Park', 'CA', '94928', '(707) 584-1582', 'http://www.rpanimalshelter.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nLicenses, Community Services, May I Help, Senior Citizens Services, See Senior Services In The Yellow Pages\n'); INSERT INTO `default_table` VALUES (259, 'Placer County SPCA', '150 Corporation Yard Road', 'Roseville', 'CA', '95678', '(530) 885-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (260, 'Placer County Spca', '150 Corporation Yard Road', 'Roseville', 'CA', '95678', '(916) 782-7722', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (261, 'S P C A Sacramento Society for the Prevention OR Cruelty To ANIM', '6201 Florin Perkins Road', 'Sacramento', 'CA', '95828', '(916) 383-7387', 'http://www.sspca.com', '', '', '11:00 A.m. To 6:00 P.m. Tuesday Through Sunday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSSPCA Spring/Fall Book Sale, Donation Appreciated, Year Round, (501 C 3 Charity - Tax Deductible)\n'); INSERT INTO `default_table` VALUES (262, 'We Care Animal Rescue Inc', '1345 Charter Oak Avenue', 'Saint Helena', 'CA', '94574', '(707) 963-7044', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPREGNANT? WORRIED? CALL WE CARE, FREE PREGNANCY TESTS & COUNSELING CONFIDENTIAL, 24 HOUR HOT LINE ALL OPTIONS EXPLORED\n'); INSERT INTO `default_table` VALUES (263, 'Monterey County Animal Services', '160 Hitchcock Road', 'Salinas', 'CA', '93908', '(831) 769-8850', 'http://www.co.monterey.ca.us/health/animalservices', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (264, 'Monterey County Spca-Humane Society', '1002 Monterey Salinas Highway', 'Salinas', 'CA', '93908', '(831) 422-4721', 'http://www.spcamc.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nAn Independent Donor-Supported Humane Society, Serving The Community Since 1905, Companion Animals For Adoption, Pet Adoption Center Ext 233 Or 234, Low Cost Spay/Neuter Clinic Ext 218, Humane... (Show More)\nAn Independent Donor-Supported Humane Society, Serving The Community Since 1905, Companion Animals For Adoption, Pet Adoption Center Ext 233 Or 234, Low Cost Spay/Neuter Clinic Ext 218, Humane Investigations Ext 213, Wildlife Rescue Ext 227, Volunteer Opportunities Ext 223  (Show Less)\n'); INSERT INTO `default_table` VALUES (265, 'Rebel Run Canine Suites', '20312 Riverside Drive', 'Santa Ana', 'CA', '92707', '(714) 751-5068', '', '', '', 'Open 7 Days A Week', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (266, 'Goleta City - Animal Control Services', '5473 Overpass Road', 'Santa Barbara', 'CA', '93101', '(805) 681-5285', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (267, 'Marine Mammal Center', '389 North Hope Avenue', 'Santa Barbara', 'CA', '93110', '(805) 687-3255', '', '', '', '', '\nAdditional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (268, '10th Life Foundation Cat Shelter', '4434 Hollister Avenue', 'Santa Barbara', 'CA', '93110', '(805) 683-0505', '', '', '', '', ''); INSERT INTO `default_table` VALUES (269, 'Animal Services - Animal Shelter Goleta', '5473 Overpass Road', 'Santa Barbara', 'CA', '93111', '(805) 681-5285', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (270, 'Dog Adoption & Welfare', '5480 Overpass Road', 'Santa Barbara', 'CA', '93111', '(805) 681-0561', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (271, 'Animal Shelter Assistance Program', '5473 Overpass Road', 'Santa Barbara', 'CA', '93111', '(805) 683-3368', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (272, 'Humane Society Silicon Valley', '2530 Lafayette Street', 'Santa Clara', 'CA', '95050', '(408) 727-3383', 'http://www.hssv.org', '', '', 'Monday-Friday 10:30am-7pm Saturday-Sunday 10am-6pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Adoptions, The Best Place To Adopt A Pet, Silicon Valley, All Animals Are, Sprayed/neutered, Vaccinated, Microchipped, Health & Behavior Tested, Car Donations\n'); INSERT INTO `default_table` VALUES (273, 'All Wild Life Rehabilitators', '1855 17th Avenue', 'Santa Cruz', 'CA', '95062', '(831) 462-0726', '', '', '', '24 Hours a Day', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nFor Sick Injured & Orphaned Wildlife With Medical Care & Skilled Specialists, Licensed Wildlife Facility, Native Animal Rescue\n'); INSERT INTO `default_table` VALUES (274, 'SPCA', '2260 7th Avenue', 'Santa Cruz', 'CA', '95062', '(831) 465-5000', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (275, 'Animal Shelter Santa Maria', '3415 Orcutt Road', 'Santa Maria', 'CA', '93436', '(805) 934-6119', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (276, 'Forgotten Felines Of Sonoma County', '1814 Empire Industrial Court', 'Santa Rosa', 'CA', '95403', '(707) 576-7999', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nMay I Help, Volunteer Information\n'); INSERT INTO `default_table` VALUES (277, 'Sonoma County Animal Shelter', '1247 Century Court', 'Santa Rosa', 'CA', '95403', '(707) 565-7100', 'http://www.theanimalshelter.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nHome Of Paws For Love, Widest Selection Of Adoptable Animals, Community Outreach, Dog Training Education Programs Low & No Cost Spay/Neuter Disaster Response, Mobile Animal Center, Mobile Adoptions... (Show More)\nHome Of Paws For Love, Widest Selection Of Adoptable Animals, Community Outreach, Dog Training Education Programs Low & No Cost Spay/Neuter Disaster Response, Mobile Animal Center, Mobile Adoptions Microchips Spay/Neuter And Vaccinations, Public Safety, Dangerous Animal & Humane Investigation Dog & Cat Licensing Nuisance  (Show Less)\n'); INSERT INTO `default_table` VALUES (278, 'Bird Rescue Center', '3430 Chanate Road', 'Santa Rosa', 'CA', '95404', '(707) 523-2473', '', '', '', 'Hours Vary', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (279, 'Project Wildlife Business Office', '8400 N Magnolia Avenue', 'Santee', 'CA', '92071', '(619) 449-4145', '', '', '', '', ''); INSERT INTO `default_table` VALUES (280, 'San Bernardino County - Health Department Public, Animal Care And Control, Devore Animal Shelter', '1977 Shorter Street', 'San Bernardino', 'CA', '92407', '(909) 887-8055', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (281, 'Paws', '7007 Friars Road', 'San Diego', 'CA', '92108', '(619) 293-3335', '', '', '', '', ''); INSERT INTO `default_table` VALUES (282, 'Project Wildlife', '887 Sherman Street', 'San Diego', 'CA', '92110', '(619) 692-9453', 'http://www.projectwildlife.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (283, 'P A W S San Diego County', '887 Sherman Street', 'San Diego', 'CA', '92110', '(619) 297-7297', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (284, 'San Diego Humane Society And Spca', '5500 Gaines Street', 'San Diego', 'CA', '92110', '(619) 299-7012', 'http://www.sdhumane.org', '', '', 'Until 11am Monday-Friday 11am-6 Pm Saturday Sunday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nCome See How Dog Training Has Changed, Modern Dog-Friendly Techniques Make Training Fun And Effective For All Dogs, Small Classes - Private Consultations, Affordable Training & Support\n'); INSERT INTO `default_table` VALUES (285, 'Project Wildlife', '4343 Morena Boulevard', 'San Diego', 'CA', '92117', '(858) 866-0555', '', '', '', '', ''); INSERT INTO `default_table` VALUES (286, 'Animal Protection And Rescue League', '5497 Clairemont Mesa Boulevard', 'San Diego', 'CA', '92117', '(858) 541-0240', '', '', '', '', ''); INSERT INTO `default_table` VALUES (287, 'Wildwings Of Calif', '1837 Fernridge Drive', 'San Dimas', 'CA', '91773', '(909) 592-4900', 'http://www.wildwings.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (288, 'S F City & County - Animal Care & Control, General Information', '1200 15th Street At Harri', 'San Francisco', 'CA', '94102', '(415) 554-6364', '', '', '', '', ''); INSERT INTO `default_table` VALUES (289, 'Ark of Refuge Youthmap', '1025 Howard Street', 'San Francisco', 'CA', '94103', '(415) 861-6566', 'http://www.arkofrefuge.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (290, 'Paws', '645 Harrison Street', 'San Francisco', 'CA', '94107', '(415) 979-9550', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (291, 'San Francisco SPCA', '2500 16th Avenue', 'San Francisco', 'CA', '94116', '(415) 554-3030', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (292, 'Marine Mammal Center', '39 Pier', 'San Francisco', 'CA', '94133', '(415) 289-7325', 'http://www.marinemammalcenter.org', '', '', '24 Hour Service', '\nProducts & Services:
\n\n
Specialties:
\n\n
Description:
\nFounded in 1975, this center—the largest marine mammal facility in the world—rescues injured or sick animals from sites stretching along the West Coast and nurses them back to health. Come for a... (Show More)\nFounded in 1975, this center—the largest marine mammal facility in the world—rescues injured or sick animals from sites stretching along the West Coast and nurses them back to health. Come for a tour to learn how the hospital rescues, rehabilitates, and releases hundreds of dolphins, sea lions, and otters each year, and see these animals during the recovery process. Note that winter is usually the quietest time of year, sometimes with one or two animals on site, whereas spring is the busiest. (Daily 10 am-4 pm, closed Jan 1, Thanksgiving, Dec 25)  (Show Less)\n'); INSERT INTO `default_table` VALUES (293, 'San Gabriel Valley Humane Society', '851 East Grand Avenue', 'San Gabriel', 'CA', '91776', '(626) 443-1861', '', '', '', '', ''); INSERT INTO `default_table` VALUES (294, 'San Gabriel Valley Humane Society', '851 East Grand Avenue', 'San Gabriel', 'CA', '91776', '(626) 286-1159', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (295, 'Ramona Animal Shelter Inc', '831 West 7th Street', 'San Jacinto', 'CA', '92582', '(951) 654-8002', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (296, 'San Jose City Of', '2750 Monterey Highway', 'San Jose', 'CA', '95111', '(408) 578-7297', 'http://www.sanjoseanimals.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (297, 'Schwartz M B Dvm', '1555 South Winchester Boulevard', 'San Jose', 'CA', '95128', '(408) 379-5554', '', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (298, 'Toy Breed Rescue', '1555 South Winchester Boulevard', 'San Jose', 'CA', '95128', '(408) 379-5554', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nBAY AREA SHIH TZU RESCUE, PLACEMENT AND ADOPTION, Shih Tzu Yorkies Maltese Lhasa Apsos Poodles Schnauzer AND MORE, 2004 VERIZON DIRECTORIES CORP\n'); INSERT INTO `default_table` VALUES (299, 'San Juan Capistrano City - Animal Control', '32400 Paseo Adelanto', 'San Juan Capistrano', 'CA', '92675', '(949) 249-5160', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (300, 'SCAP', '30200 Rancho Viejo Road', 'San Juan Capistrano', 'CA', '92675', '(949) 489-7676', 'http://www.scap1.org', '', '', '', '\nAdditional Information:
\nWater & Sewage Companies-Utility\n'); INSERT INTO `default_table` VALUES (301, 'Woods Humane Society Business Office', '277 South Street', 'San Luis Obispo', 'CA', '93401', '(805) 543-9030', 'http://www.woodshumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (302, 'Herpetological Rescue Services-A Nonprofit Public Benefit Califo', '1640 Viaduct Cancion', 'San Marcos', 'CA', '92078', '(760) 744-7699', 'http://www.herp-rescue.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (303, 'Santa Clara County - Animal Shelter', '12370 Murphy Avenue', 'San Martin', 'CA', '95046', '(408) 683-4186', 'http://www.santaclaracounty.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (304, 'Peninsula Humane Society & SPCA', '12 Airport Boulevard', 'San Mateo', 'CA', '94401', '(650) 340-7022', 'http://phs-spca.org', '', '', 'Open Mon-Fri', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDog Cat Rabbit And Small Animal Adoptions, Wildlife Care Center, Low-Cost Spay/Neuter Clinic, Dog Training Classes, Animal Behavior Helpline\n'); INSERT INTO `default_table` VALUES (305, 'O''Brien Animal Transportation', '430 Peninsula Avenue', 'San Mateo', 'CA', '94401', '(650) 348-0547', 'http://www.animaltransportation.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (306, 'Marine Mammal Care Center At Fort Macarthur', '3601 South Gaffey Street', 'San Pedro', 'CA', '90731', '(310) 548-5677', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (307, 'International Bird Rescue Research Center', '930 West 36th Street', 'San Pedro', 'CA', '90731', '(310) 514-2573', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (308, 'Pet Saves Rabbitat and Gifts', '522 West 9th Street', 'San Pedro', 'CA', '90731', '(310) 833-7333', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (309, 'California Center For Wildlife', '76 Albert Park Lane', 'San Rafael', 'CA', '94901', '(415) 454-6961', '', '', '', '', ''); INSERT INTO `default_table` VALUES (310, 'Animal Legal Defense Fund', '1363 Lincoln Avenue', 'San Rafael', 'CA', '94901', '(415) 459-0885', '', '', '', '', ''); INSERT INTO `default_table` VALUES (311, 'Marin County - Animal Services, Health & Human Services Department, Public Health Division', '20 North San Pedro Road Suite 2024', 'San Rafael', 'CA', '94903', '(415) 883-4621', 'http://www.marinhumanesociety.org', '', '', '24 Hour Emergency Service', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nRescue Rehabilitate & Rehome, 24 Hour Emergency Rescue X 1, Adoptions X225, Donations X257, Education X288, Lost Dogs/Cats X377/x378, Monthly Shot Clinics X262, Pet Supplies X229, Behavior &... (Show More)\nRescue Rehabilitate & Rehome, 24 Hour Emergency Rescue X 1, Adoptions X225, Donations X257, Education X288, Lost Dogs/Cats X377/x378, Monthly Shot Clinics X262, Pet Supplies X229, Behavior & Training X280  (Show Less)\n'); INSERT INTO `default_table` VALUES (312, 'Northbay Grooming & Boarding', '4240 Redwood Highway', 'San Rafael', 'CA', '94903', '(415) 479-7297', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nFor Loving And Professional Net Bathing And Grooming, Bathing For Dogs & Cats, Flexible Pricing, Elder Care For Senior Pets, Boarding Available (See Our Ad Under Kennels)\n'); INSERT INTO `default_table` VALUES (313, 'Wildcare Terwilliger Nature Education', '76 Albert Park Lane', 'San Rafael', 'CA', '94901', '(415) 453-1000', '', '', '', '', ''); INSERT INTO `default_table` VALUES (314, 'Birds Fe Rescue Service American Inc', '1296 Conference Drive', 'Scotts Valley', 'CA', '95066', '(831) 335-3232', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (315, 'Seal Beach Animal Care Center', '1700 Adolfo Lopez Drive', 'Seal Beach', 'CA', '90740', '(562) 430-4993', 'http://www.sbacc.org', 'sbacc@earthlink.net', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (316, 'Seal Beach Animal Shelter', '1700 Adolpho Lopez Drive', 'Seal Beach', 'CA', '90740', '(562) 430-4993', 'http://www.sbacc.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (317, 'Selma Animal Shelter', '16097 South McCall Avenue', 'Selma', 'CA', '93662', '(559) 891-7387', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nGovernment Offices-City, Village & Township\n'); INSERT INTO `default_table` VALUES (318, 'Pawed', '4050 Durock Road', 'Shingle Springs', 'CA', '95682', '(530) 677-2476', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (319, 'Pets Lifeline Animal Shelter', '19686 8th Street East', 'Sonoma', 'CA', '95476', '(707) 996-9982', 'http://www.petslifeline.org', '', '', 'Tuesday Through Friday 12 To 5 Pm Saturday 11 Am To 5 Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (320, 'Pets Lifeline Non Profit Animal Shelter', '19686 East 8th Street', 'Sonoma', 'CA', '95476', '(707) 996-4577', '', '', '', '', ''); INSERT INTO `default_table` VALUES (321, 'El Dorado County - Animal Control, South Lake Tahoe', '1120 Shakori Drive', 'South Lake Tahoe', 'CA', '96150', '(530) 577-1766', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (322, 'Tahoe Wildlife Care Lake', '1485 Cherry Hills Circle', 'South Lake Tahoe', 'CA', '96150', '(530) 577-2273', 'http://www.ltwc.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (323, 'National Cat Protection Society', '9031 Birch Street', 'Spring Valley', 'CA', '91977', '(619) 469-8771', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nA Non-Profit Organization Estab 1968, Adoptions & Placement Services Retirement Center, Adorable Cats & Kittens, Mixed & Pure Breeds, Leukemia Tested, Donations Are Vital To Our Existence\n'); INSERT INTO `default_table` VALUES (324, 'Adopt-A-Pet', '7475 Murray Drive', 'Stockton', 'CA', '95210', '(209) 956-3647', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (325, 'Stockton Animal Shelter Friends', '7475 Murray Drive', 'Stockton', 'CA', '95210', '(209) 956-3647', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (326, 'Suisun Wildlife Rehabilitation Center', '1171 Kellogg Street', 'Suisun City', 'CA', '94585', '(707) 429-4295', 'http://www.suisunwildlife.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nCare Of Injured & Orphaned Wildlife, Drop Off Animals, Donations Welcome\n'); INSERT INTO `default_table` VALUES (327, 'Pets In Need', '873 5th Avenue', 'Sunnyvale', 'CA', '94085', '(408) 367-1405', '', '', '', '', ''); INSERT INTO `default_table` VALUES (328, 'Collett Veterinary Clinic', '13815 Sayre Street', 'Sylmar', 'CA', '91342', '(818) 364-1544', 'http://www.designinghealth.com', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n
Additional Information:
\nSmall Animal Care, Dentistry, Flea Control, Micro chip ID\n'); INSERT INTO `default_table` VALUES (329, 'Collett Robert M DVM', '13815 Sayre Street', 'Sylmar', 'CA', '91342', '(818) 364-1544', 'http://www.designinghealth.com', '', '', 'No Appointment Necessary', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n
Additional Information:
\nSmall Animal Care, Dentistry, Flea Control, Micro chip ID\n'); INSERT INTO `default_table` VALUES (330, 'Wildlife Waystation', '14831 Little Tujunga Canyo', 'Sylmar', 'CA', '91342', '(818) 899-5201', '', '', '', '', ''); INSERT INTO `default_table` VALUES (331, 'Aaron Joy L Dvm', '13815 Sayre Street', 'Sylmar', 'CA', '91342', '(818) 364-1544', 'http://www.collettvet.com', '', '', 'Monday-Friday 7:00Am-12:00Pm-2:00Pm-6:00Pm,saturday 7:00Am-12:00Pm', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (332, 'Hohne Mark A', '13815 Sayre Street', 'Sylmar', 'CA', '91342', '(818) 364-1544', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (333, 'Cisneros Pedro Dvm', '13815 Sayre Street', 'Sylmar', 'CA', '91342', '(818) 364-1544', 'http://www.collettvet.com', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Additional Information:
\nCollett Veterinary Clinic, Small Animal Care\n'); INSERT INTO `default_table` VALUES (334, 'Animal Samaritans Spca', '72307 Ramon Road', 'Thousand Palms', 'CA', '92276', '(760) 343-3477', 'http://www.animalsamaritans.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLow Cost, Spay, Neuter And\n'); INSERT INTO `default_table` VALUES (335, 'Tracy City - Animal Shelter', '370 Arbor Road', 'Tracy', 'CA', '95304', '(209) 831-4364', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (336, 'Dale Baker Hoof Trimming Inc', '19598 Road 124', 'Tulare', 'CA', '93274', '(559) 686-2364', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (337, 'Palms N Paws Animal Shelter', '7086 Bullion Avenue', 'Twentynine Palms', 'CA', '92277', '(760) 367-0157', 'http://www.palmsnpaws.petfinder.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (338, 'Twentynine Palms Animal Care & Control Department', '7086 Bullion Avenue', 'Twentynine Palms', 'CA', '92277', '(760) 367-0157', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (339, 'Twentynine Palms City - Animal Care and Control Department', '7086 Bullion Avenue', 'Twentynine Palms', 'CA', '92277', '(760) 367-0157', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (340, 'Upland Animal Shelter', '860 East 15th Street', 'Upland', 'CA', '91786', '(909) 931-4185', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (341, 'Humane Animal Services', '51 Commerce Place', 'Vacaville', 'CA', '95687', '(707) 449-1700', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (342, 'Pet Orphans of Southern California', '7720 Gloria Avenue', 'Van Nuys', 'CA', '91406', '(818) 901-0190', 'http://www.petorphans.org', 'pof@petorphansfund.org', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDedicated To Pet Rescue Adoption Medical Care & Humane Education Since 1973\n'); INSERT INTO `default_table` VALUES (343, 'Canine Adoption & Rescue League', '3004 Telegraph Road', 'Ventura', 'CA', '93003', '(805) 652-1001', 'http://www.humaneleague.com', '', '', 'Saturday 11:00 A.m.-4:00 P.m. Sunday 12:00 P.m.-4:00 P.m.', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (344, 'Ventura Pet Barn', '3004 Telegraph Road', 'Ventura', 'CA', '93003', '(805) 652-1001', 'http://www.venturapetbarn.com', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (345, 'Kennedy Robert Animal Nutritionist', '2936 South Willis Court', 'Visalia', 'CA', '93277', '(559) 732-8834', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (346, 'Visalia & Dinuba Licensing', '29016 Highway 99', 'Visalia', 'CA', '93277', '(559) 651-1111', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (347, 'Visalia Animal Control Shelter & Adoptions', '29016 Highway 99', 'Visalia', 'CA', '93277', '(559) 651-1111', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (348, 'Valley Oak SPCA Spay & Neuter Clinic', '2622 East Main Street', 'Visalia', 'CA', '93292', '(559) 741-1121', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (349, 'Watsonville City - Animal Shelter', '580 Airport Boulevard', 'Watsonville', 'CA', '95076', '(831) 454-7303', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (350, 'Tingle Lynne', '10670 Hearst Road', 'Willits', 'CA', '95490', '(707) 459-9400', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (351, 'Los Angeles Spca', '6100 Topanga Canyon Boulevard', 'Woodland Hills', 'CA', '91367', '(818) 932-7988', 'http://www.spcala.com', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (352, 'Society For Prevention Of Cruelty To Animals-Los Angeles', '6100 Topanga Canyon Boulevard', 'Woodland Hills', 'CA', '91367', '(818) 932-7988', 'http://www.spcala.com', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (353, 'Yuba-Sutter Low Cost Spay Neuter Vaccinations', '1368 Colusa Highway', 'Yuba City', 'CA', '95993', '(530) 674-7729', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nFor Your Convenience We Are Open 7 Days A Week\n'); INSERT INTO `default_table` VALUES (354, 'Yucaipa Valley Animal Placement Society', '11937 13th Street', 'Yucaipa', 'CA', '92399', '(909) 790-1440', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (355, 'The Cat Spa', '12410 West 44th Avenue', 'Arvada', 'CO', '80002', '(303) 422-7300', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nPamper Your, Each Guest Has A Huge Private Suite With It''s Own Outdoor Playroom Complete With Exercise Trapeze, 1st Class Boarding & Grooming Since 1959\n'); INSERT INTO `default_table` VALUES (356, 'Action Grooming & Kennels', '12975 West 80th Avenue', 'Arvada', 'CO', '80005', '(303) 423-2243', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nProfessional Dog & Cat Grooming, All Breeds - Pet & Show, We Handle With Care - Call For Appt\n'); INSERT INTO `default_table` VALUES (357, 'Cat Cradle Cattery', '4363 Kipling', 'Arvada', 'CO', '80002', '(303) 424-2424', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\n~Best Of Westwood 2002~, Skylights & Stereo Music, Air Conditioned, Special Diets & Medications, Daily Exercise, Inspections Welcomed, Lots Of Love, Pick Up & Delivery Avail, Serving Denver Since... (Show More)\n~Best Of Westwood 2002~, Skylights & Stereo Music, Air Conditioned, Special Diets & Medications, Daily Exercise, Inspections Welcomed, Lots Of Love, Pick Up & Delivery Avail, Serving Denver Since 1954, Cats Only, Please Call For Reservations  (Show Less)\n'); INSERT INTO `default_table` VALUES (358, 'Aspen Pitkin County Animal Shelter And Boarding Kennel', '212 Aspen Airport Busine', 'Aspen', 'CO', '81611', '(970) 544-0206', 'http://www.dogsaspen.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (359, 'Aurora Animal Shelter', '15750 East 32nd Avenue', 'Aurora', 'CO', '80011', '(303) 326-8280', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (360, 'Aurora Animal Shelter', '15750 East 32nd Avenue', 'Aurora', 'CO', '80011', '(303) 326-8288', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (361, 'Vincent B', '14202 East 28th Avenue', 'Aurora', 'CO', '80011', '(303) 366-3357', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (362, 'Cavy Care Inc', '4343 South Jasper Street', 'Aurora', 'CO', '80015', '(303) 693-4630', 'http://www.cavycareinc.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (363, 'Andre''s Amazon Rain Forest Educational Program', '2043 Elmira Street', 'Aurora', 'CO', '80010', '(303) 360-6927', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (364, 'Bath & Doggy Works', '10 South Potomac Street', 'Aurora', 'CO', '80012', '(303) 361-0061', 'http://www.bbfordog.com', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nBath & Doggy Works, Full Service Grooming, All Breeds & Sizes Welcome, Scissor Finishing, Hydrosurge Bathing, Coat Dematting, Ear Cleaning, Blow Dry, Teeth Brushing, No Tranquilizers\n'); INSERT INTO `default_table` VALUES (365, 'A All Animal Control', '5588 South Parker Road', 'Aurora', 'CO', '80015', '(303) 452-2113', 'http://www.wildpests.com', '', '', 'Available On Weekends', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nWe Remove Relocate Repair and Clean Up!, We Are The Most Gentle & Complete Wildlife Service Or It''s Free! Wildlife Biologist On Staff, Humane Removal Of Animals In Chimneys, WILDLIFE CONTROL... (Show More)\nWe Remove Relocate Repair and Clean Up!, We Are The Most Gentle & Complete Wildlife Service Or It''s Free! Wildlife Biologist On Staff, Humane Removal Of Animals In Chimneys, WILDLIFE CONTROL SERVICES, PEST CONTROL SERVICES, Bees/Wasps, Voles, Bed Bugs, prairie Dogs, Cockro  (Show Less)\n'); INSERT INTO `default_table` VALUES (366, 'Carpet Direct', '2252 Vigilante', 'Bailey', 'CO', '80421', '(303) 816-2273', '', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Additional Information:
\nServing All of southern Colorado, YOU ARE THE MIDDLE MAN, Manufacturers Direct to You All Name Brand Carpets at the, Lowest Prices Possible, Hundreds of Patterns To Choose From, All the Latest... (Show More)\nServing All of southern Colorado, YOU ARE THE MIDDLE MAN, Manufacturers Direct to You All Name Brand Carpets at the, Lowest Prices Possible, Hundreds of Patterns To Choose From, All the Latest Styles, Carpet Tile Wood Vinyl Stone, Free In Home Appointments (Day Evenings Weekends  (Show Less)\n'); INSERT INTO `default_table` VALUES (367, 'Wilderness Ranch Sanctuary for Farm Animals', '19595 Buckhorn', 'Bellvue', 'CO', '80512', '(970) 493-7153', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (368, 'Longhopes Donkey Shelter', '50 South Dutch Valley Road', 'Bennett', 'CO', '80102', '(303) 644-5930', 'http://www.longhopes.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (369, 'Humane Society of Boulder Valley', '2323 55th Street', 'Boulder', 'CO', '80301', '(303) 442-4030', 'http://www.boulderhumane.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (370, 'Birds of Prey Foundation', '2005 US Highway 287', 'Broomfield', 'CO', '80020', '(303) 460-0674', 'http://www.birds-of-prey.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (371, 'House Rabbit Society', '12601 Lowell Boulevard', 'Broomfield', 'CO', '80020', '(303) 469-3240', 'http://www.coloradohrs.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n
Certification & Affiliations:
\n\n'); INSERT INTO `default_table` VALUES (372, 'Veterinary Emergency & Referral Center Of Northwest Denver', '1480 West Midway Boulevard', 'Broomfield', 'CO', '80020', '(303) 464-7744', '', '', '', '', ''); INSERT INTO `default_table` VALUES (373, 'Ark-Valley Humane Society', '701 Gregg Drive', 'Buena Vista', 'CO', '81211', '(719) 395-2737', 'http://www.ark-valley.org', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Additional Information:
\nWHERE HOMELESS ANIMALS FIND THEIR FUR-EVER HOMES\n'); INSERT INTO `default_table` VALUES (374, 'Ellicott Wildlife Rehabilitation Center', '23350 State Highway 94', 'Calhan', 'CO', '80808', '(719) 683-8152', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (375, 'Humane Society Shelter House', '110 Rhodes Avenue', 'Canon City', 'CO', '81212', '(719) 275-0663', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (376, 'Eagle County Animal Control', '900 El Jebel Road', 'Carbondale', 'CO', '81623', '(970) 963-2948', 'http://www.eagle-county.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (377, 'Dumb Friends League - Buddy Center Dumb Friends League, Receptionist', '4556 Castleton Court', 'Castle Rock', 'CO', '80109', '(303) 751-5772', '', '', '', '', ''); INSERT INTO `default_table` VALUES (378, 'Humane Society Roice Hurst', '3320 D 1/2 Road', 'Clifton', 'CO', '81520', '(970) 434-7337', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdoption Relinquishment Cremation, Sterilization/Shot Clinic\n'); INSERT INTO `default_table` VALUES (379, 'Denkai Animal Sanctuary', '10450 State Highway 94', 'Colorado Springs', 'CO', '80929', '(970) 897-3122', '', '', '', '', ''); INSERT INTO `default_table` VALUES (380, 'Animal Instincts', '20 Mount View Lane Suite C', 'Colorado Springs', 'CO', '80903', '(719) 264-6460', 'http://www.animal-instincts.org', '', 'From Small To Tall We Train Them All', 'Mon-Fri: 08:00am-05:00pm', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Certification & Affiliations:
\n\n'); INSERT INTO `default_table` VALUES (381, 'Wild Forever Foundation', '1524 North Hancock Avenue', 'Colorado Springs', 'CO', '80903', '(719) 475-9453', 'http://www.contractors.com/h/contractorinfo/details.html?contractor_id=4732367&affid=101', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (382, 'Colorado Springs All Breed''s Rescue', '20 Mount View Lane Suite C', 'Colorado Springs', 'CO', '80907', '(719) 264-6460', 'http://www.csabr.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nRelationship Based Training Through Trust And Respect, Manners / Obedience, Behavior Evaluations / Counseling, Agility Freestyle Tricks Therapy And More\n'); INSERT INTO `default_table` VALUES (383, '9 Lives Rescue', '3445 Nonchalant East', 'Colorado Springs', 'CO', '80917', '(719) 591-4640', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (384, 'Homefinderspet Placement', '2840 North Powers Boulevard', 'Colorado Springs', 'CO', '80922', '(719) 380-9656', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (385, 'Front Range Equine Rescue', '6995 Horseshoe Road', 'Colorado Springs', 'CO', '80923', '(719) 495-6389', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (386, 'Humane Society Of The Pikes Peak Region', '610 Abbot Lane', 'Colorado Springs', 'CO', '80905', '(719) 473-1741', 'http://www.hsppr.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdoptions Services, Lost & Found Pets, Burial, Cremation, Outreach & Education\n'); INSERT INTO `default_table` VALUES (387, 'El Paso County Government - Animal Control, Dead Animals, Humane Society', '610 Abbot Lane', 'Colorado Springs', 'CO', '80905', '(719) 473-1741', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (388, 'Humane Society Of The Pikes Peak Region', '610 Abbot Lane', 'Colorado Springs', 'CO', '80905', '(719) 444-8437', '', '', '', '', ''); INSERT INTO `default_table` VALUES (389, 'B& B Pet Services', '860 West 132nd Avenue Lot 195', 'Denver', 'CO', '80234', '(303) 252-0881', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nServing the Northern, In Home Care, Midday Walks\n'); INSERT INTO `default_table` VALUES (390, 'Safe Harbor Laboratory Rescue', '601 16th Street', 'Denver', 'CO', '80202', '(303) 464-7777', 'http://www.safeharborlabrescue.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (391, 'Maxfund - Maxfund Animal Shelter', '1025 Galapago Street', 'Denver', 'CO', '80204', '(303) 595-4917', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (392, 'Animal Rescue & Adoption Society', '2390 South Delaware Street', 'Denver', 'CO', '80223', '(303) 744-6076', '', '', '', 'Weekdays 12:00Am-5:00Pm Weekends Closed 12:00Am-4:00Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (393, 'Denver City & County - Environmental Health, Animal Control Division, West Nile Virus Information', '678 South Jason Street', 'Denver', 'CO', '80223', '(303) 698-0076', '', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (394, 'Colorado Equine (horse) Crisis Intervention', '7373 East Iowa Avenue', 'Denver', 'CO', '80231', '(303) 695-1299', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (395, 'Dumb Friends League Humane Society Of Denver Inc - Animal Cruelty Invesitgations', '2080 South Quebec Street', 'Denver', 'CO', '80231', '(303) 923-0022', 'http://www.rottieaid.org', '', '', 'M. Tuesdays 6:30 P.m.-7:30 P.m.', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (396, 'Dumb Friends League - Receptionist', '2080 South Quebec Street', 'Denver', 'CO', '80231', '(303) 671-5212', 'http://www.ddfl.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (397, 'Dumb Friends League Humane Society Of Denver Inc - Business Office', '2080 South Quebec Street', 'Denver', 'CO', '80231', '(303) 696-4941', 'http://www.ddfl.org', '', '', 'M. Tuesdays 6:30 P.m.-7:30 P.m.', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (398, 'Dumb Friends League - Adoptions And Receiving', '2080 South Quebec Street', 'Denver', 'CO', '80231', '(303) 751-5772', 'http://www.ddfl.org', '', '', 'M. Tuesdays 6:30 P.m.-7:30 P.m.', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (399, 'Animal Orphanage', '2345 S Federal Boulevard', 'Denver', 'CO', '80219', '(303) 575-9070', '', '', '', '', ''); INSERT INTO `default_table` VALUES (400, 'Teller County Regional Animal Shelter', '308 Weaverville Road', 'Divide', 'CO', '80814', '(719) 686-7707', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (401, 'Animal Shelter', '3549 County Road 312', 'Dumont', 'CO', '80436', '(303) 679-2398', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (402, 'Animal Shelter', '1111 South Camino Del Rio', 'Durango', 'CO', '81303', '(970) 259-2847', 'http://www.lpchumanesociety.org', '', '', 'Monday 10:00-4:30 Monday 9:00-6:00 Tuesday 10:00-4:30 Tuesday 9:00-6:00', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (403, 'La Plata County Government - Animal Control, Humane Society', '1111 South Camino Del Rio', 'Durango', 'CO', '81303', '(970) 259-2847', 'http://www.lpchumanesociety.org', '', '', 'Monday 10:00-4:30 Monday 9:00-6:00 Tuesday 10:00-4:30 Tuesday 9:00-6:00', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (404, 'Eagle County Animal Control & Shelter', '1400 Fairgrounds Road', 'Eagle', 'CO', '81631', '(970) 328-3647', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (405, 'Colorado Humane Society & SPCA', '2760 South Platte River Drive', 'Englewood', 'CO', '80110', '(303) 781-9344', 'http://www.coloradohumane.org', 'taylor_rees@excite.com', '', 'Monday To Friday 9am To 6pm Saturday 9am To 5pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLOST AND FOUND ANIMALS PET ADOPTIONS CRUELTY INVESTIGATIONS SPAY & NEUTER CLINIC\n'); INSERT INTO `default_table` VALUES (406, 'Humane Society of Weld County', '1620 42nd Street', 'Evans', 'CO', '80620', '(970) 506-9550', '', 'info@dalmatianrescue.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (407, 'Colorado Greyhound Companions', '305 East Thunderbird Drive', 'Fort Collins', 'CO', '80525', '(970) 207-1064', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (408, 'Larimer Humane Society', '6317 Kyle Avenue', 'Fort Collins', 'CO', '80525', '(970) 226-3647', 'http://www.larimerhumane.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAnimals Available For Adoption, Volunteer Opportunities, WildLife Rehabilitation, Animal Protection & Control\n'); INSERT INTO `default_table` VALUES (409, 'Fort Morgan City Government - Animal Shelter', '900 East Railroad Avenue', 'Fort Morgan', 'CO', '80701', '(970) 542-3927', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (410, 'Dumb Friends League-Buddy Center', '4556 Castleton Court', 'Franktown', 'CO', '80116', '(303) 751-5772', '', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (411, 'Summit County Government - Open Space & Trails Department', '37 Peak One Drive', 'Frisco', 'CO', '80443', '(970) 668-4060', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (412, 'Colorado Animal Rescue', '2801 County Road 114', 'Glenwood Springs', 'CO', '81601', '(970) 947-9173', 'http://www.coloradoanimalrescue.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (413, 'Golden Retriever Rescue Of The Rockies', '601 16th Street', 'Golden', 'CO', '80401', '(303) 279-2400', 'http://www.golden-retriever.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (414, 'Pet Camp Boarding Kennels', '6088 Highway 93', 'Golden', 'CO', '80403', '(303) 279-8045', 'http://www.petcamp.info', '', '', 'Open 7 Days A Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDOG & CAT BOARDING IN A COUNTRY SETTING\n'); INSERT INTO `default_table` VALUES (415, 'Table Mountain Animal Center', '4105 Youngfield Street', 'Golden', 'CO', '80401', '(303) 278-7575', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (416, 'Jefferson County - Animal Shelter', '4105 Youngfield Street', 'Golden', 'CO', '80401', '(303) 278-7575', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (417, 'Pals Animal Rescue', '24060 US Highway 40', 'Golden', 'CO', '80401', '(303) 526-1810', '', '', '', '', ''); INSERT INTO `default_table` VALUES (418, 'Grand County Government - Animal Control', '3475 County Road 57', 'Granby', 'CO', '80446', '(970) 887-2988', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (419, 'Animal Control Services', '362 28 Road', 'Grand Junction', 'CO', '81501', '(970) 242-4646', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (420, 'Humane Society - Humane Society Of Western Colorado-Foster Care Mess', '200 Grand Avenue Frnt', 'Grand Junction', 'CO', '81501', '(970) 243-8823', 'http://www.lpchumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (421, 'Audubon Society Grand Valley', '337 25 3/4 Road', 'Grand Junction', 'CO', '81503', '(970) 241-4670', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (422, 'Gunnison Valley Animal Welfare League', '304 West Tomichi Avenue', 'Gunnison', 'CO', '81230', '(970) 641-1173', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (423, 'Rocky Mountain Wildlife Conservation Center', '1850 Weld County Road 53', 'Hudson', 'CO', '80642', '(303) 536-0118', 'http://www.wildlife-conservation.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (424, 'Clear Creek County Government', '405 Argentine', 'Idaho Springs', 'CO', '80452', '(303) 569-3251', '', '', '', '', ''); INSERT INTO `default_table` VALUES (425, 'Cat Care Society', '5787 West 6th Avenue', 'Lakewood', 'CO', '80214', '(303) 239-9690', 'http://www.catcaresociety.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nCat Adoptions, Spray & Neuter Info, Thrift Shop, Volunteer & Education Programs, Humane Trap Rentals, Gift Shop\n'); INSERT INTO `default_table` VALUES (426, 'Cat Care Society', '5787 West 6th Avenue', 'Lakewood', 'CO', '80214', '(303) 239-9680', 'http://www.catcaresociety.org', 'catcaresociety@earthlink.net', '', 'Tue 10:00am-05:30pm
Wed-Fri: 12:00pm-05:30pm
Sat 09:00am-03:30pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nCat Adoptions, Spay & Neuter Info, Humane Trap Rentals, Volunteer & Educational Programs, Thrift Shop, Gift Shop\n'); INSERT INTO `default_table` VALUES (427, 'Cajun''s Closet', '5707 West 6th Avenue', 'Lakewood', 'CO', '80214', '(303) 239-9680', '', '', '', '', ''); INSERT INTO `default_table` VALUES (428, 'Angels With Paws', '2540 Youngfield Street', 'Lakewood', 'CO', '80215', '(303) 274-2264', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nCat Adoption and Rescue Center, Saving lives One life at a time\n'); INSERT INTO `default_table` VALUES (429, 'Lamar City Animal Shelter', '8551 County Road Ee.5 # 10', 'Lamar', 'CO', '81052', '(719) 336-8769', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (430, 'La Junta City Government - Animal Shelter', '30227 6th Avenue', 'La Junta', 'CO', '81050', '(719) 384-0347', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (431, 'Lake County Animal Shelther', '428 East 12th Street', 'Leadville', 'CO', '80461', '(719) 486-8951', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (432, 'Longmont Humane Society', '9595 Nelson Road', 'Longmont', 'CO', '80501', '(303) 772-1232', 'http://www.longmonthumane.org', 'info@longmonthumane.org', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nMake The Right Choice Adopt A Shelter Pet, Puppies Kittens Adults, Purebreds Mixed Breeds, Nominal Adoption Fee, Free Spay Of Neuter With Adoption, City Pet Licenses, Obedience Classes, Animal... (Show More)\nMake The Right Choice Adopt A Shelter Pet, Puppies Kittens Adults, Purebreds Mixed Breeds, Nominal Adoption Fee, Free Spay Of Neuter With Adoption, City Pet Licenses, Obedience Classes, Animal Behavioral Counseling, Euthanasia Cremation, Pet Cemetery, Temperament Tested  (Show Less)\n'); INSERT INTO `default_table` VALUES (433, 'Colorado Horse Rescue', '10386 North 65th Street', 'Longmont', 'CO', '80503', '(720) 494-1414', 'http://www.chr.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (434, 'Greenwood Wildlife Rehabilitation Sanctuary', '5761 Ute Highway', 'Longmont', 'CO', '80503', '(303) 823-8455', 'http://www.greenwoodwildlife.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (435, 'Conour Slv Animal Shelter', '3200 Sherman', 'Monte Vista', 'CO', '81144', '(719) 852-3366', '', '', '', '', ''); INSERT INTO `default_table` VALUES (436, 'Mile Hi Humane Society', '11470 York Street', 'Northglenn', 'CO', '80233', '(303) 452-2224', 'http://www.milehihumane.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (437, 'The Animal Clinic Of Parker', '19557 East Parker Square Drive', 'Parker', 'CO', '80134', '(720) 842-5050', '', '', '', 'Open Evenings', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (438, 'Pueblo Animal Services', '1595 Stockyard Road', 'Pueblo', 'CO', '81001', '(719) 544-3005', 'http://www.puebloas.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdoption Services, Lost & Found Pets, Euthanasia / Burial / Cremation, Outreach & Education\n'); INSERT INTO `default_table` VALUES (439, 'Animal Welfare', '3420 West 8th Street', 'Pueblo', 'CO', '81003', '(719) 543-6464', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (440, 'Rangely Animal Shelter', '407 Bronco Road', 'Rangely', 'CO', '81648', '(970) 675-2803', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (441, 'Steamboat Springs City Government - Animal Shelter', '760 Critter Court', 'Steamboat Springs', 'CO', '80487', '(970) 879-0621', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (442, 'Colorado Division Of Wildlife', '34227 County Road 38.5', 'Two Buttes', 'CO', '81084', '(719) 326-5241', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (443, 'Almost Home Adoptions For Rescued Cats', '7713 West 92nd Avenue', 'Westminster', 'CO', '80030', '(303) 432-2299', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (444, 'Yale Termite & Pest Elimination Corporation', '20 West Main Street', 'Ansonia', 'CT', '06401', '(203) 331-8664', 'http://www.yalepest.com', '', '', 'Same Day Service Available', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nInstitional, Protecting Homes Since 1983, Lawn & Shrub Division, Target Lyme Disease, Reduce The Threat Of Lyme Disease, IPM Practices, CT Business Lic B-0256, Tick Treatments, Deer Repellents,... (Show More)\nInstitional, Protecting Homes Since 1983, Lawn & Shrub Division, Target Lyme Disease, Reduce The Threat Of Lyme Disease, IPM Practices, CT Business Lic B-0256, Tick Treatments, Deer Repellents, Moles, Turf Lawn & Shurb Treatments, Pest, Mosquitos, Grubs, Wildlife, Termite And More, All Services Guaranteed In Writing, Same Day Service Based On Availability, Serving CT Since 1983, Insect, Lawn Treatments, Carpenter Ant Specialists, One Time Treatment 1 Year Guarantee, Termites, Carpenter Ants, Rats, Moths, Carpenter Bees, Fleas, Roaches, Small Ants, Wasps, Yellow Jackets, Wood Destroying Insects, More, Your Full Service Firm, Wildlife Division, Opossums, Pigeons, Chimney Caps & Vent Covers, Exclusion Workm, Sanitary Clean-Ups, A Full Staff Of Licensed Animal Technicians To Reselve Human Animal Conflicts, Emergency Animal Removal, Results Not Excuses  (Show Less)\n'); INSERT INTO `default_table` VALUES (445, 'Humane Society', '788 Amity Road', 'Bethany', 'CT', '06524', '(203) 393-0150', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (446, 'Danbury Animal Welfare Society', '147 Grassy Plain Street', 'Bethel', 'CT', '06801', '(203) 744-3297', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (447, 'Animal Shelter Assistance Program', '3661 Main Street', 'Bridgeport', 'CT', '06606', '(203) 371-8289', 'http://www.connecticutshelters.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (448, 'Cheshire Town - Animal Control, Administrative Departments, Animal Shelter Volunteers', '500 Highland Avenue', 'Cheshire', 'CT', '06410', '(203) 271-5594', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (449, 'Protectors of Animals', '144 Main Street', 'East Hartford', 'CT', '06118', '(860) 569-0722', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (450, 'Millennium Guild', '95 Belden', 'Falls Village', 'CT', '06031', '(860) 824-0831', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPegeen Fitzgerald''s Last Post\n'); INSERT INTO `default_table` VALUES (451, 'Last Post Animal Shelter', '95 Belden', 'Falls Village', 'CT', '06031', '(860) 824-0831', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (452, 'Absolutely Animals', '249 Buell Road', 'Litchfield', 'CT', '06759', '(203) 438-4020', 'http://www.absolutelyanimals.com', '', '', '24 Hour Service', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (453, 'Connecticut Humane Society', '701 Russell Road', 'Newington', 'CT', '06111', '(860) 666-3337', 'http://www.cthumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (454, 'Ct Humane Society', '701 Russell Road', 'Newington', 'CT', '06111', '(860) 594-4500', '', '', '', '', ''); INSERT INTO `default_table` VALUES (455, 'New Fairfield-Sherman Animal Welfare Society Inc', '223 State Route 37', 'New Fairfield', 'CT', '06812', '(203) 746-2925', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (456, 'Animal Welfare Society', '8 Dodd Road', 'New Milford', 'CT', '06776', '(860) 354-1350', '', 'adoptahobo@home.com', '', '', '\nAdditional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (457, 'Horse Of Connecticut', '43 Wilbur Road', 'New Preston', 'CT', '06777', '(860) 868-1960', 'http://www.horseofct.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (458, 'Animal Haven Inc', '89 Mill Road', 'North Haven', 'CT', '06473', '(203) 239-2641', 'http://www.theanimalhaven.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (459, 'Paws Pet Animal Welfare Society', '504 Main Avenue', 'Norwalk', 'CT', '06851', '(203) 750-9572', 'http://www.pawsct.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nFind A New Best Friend, Adopt A Pet, Save A Life, Helping Animals Since 1962\n'); INSERT INTO `default_table` VALUES (460, 'Love at First Sight', '330 Main Avenue', 'Norwalk', 'CT', '06851', '(203) 846-8146', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (461, 'Humane Society Connecticut', '169 Old Colchester Road', 'Quaker Hill', 'CT', '06375', '(860) 442-8583', 'http://www.cthumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (462, 'Animal Emergency Hospital Of Central Connecticut Llc', '588 Cromwell Avenue', 'Rocky Hill', 'CT', '06067', '(860) 563-4447', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nProviding After-Hours Small Animal Emergency Medicine Surgery And Critical Care\n'); INSERT INTO `default_table` VALUES (463, 'A-Aavon Pest Control', '49 Ryan Street', 'Stamford', 'CT', '06907', '(203) 329-2600', 'http://www.aavonpestcontrol.com', '', '', '8:30-4:30 Monday-Friday', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nPest & Termite Elimination, Rodent & Wildlife, Removal & Prevention, Member Better Business Bureau Connecticut\n'); INSERT INTO `default_table` VALUES (464, 'Valley Shore Animal Welfare League Inc', '647 Horse Hill Road', 'Westbrook', 'CT', '06498', '(860) 399-7561', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (465, 'Team Tait''s Every Animal Matters', '1201 Boston Post Road', 'Westbrook', 'CT', '06498', '(860) 399-5569', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (466, 'Poster Animal Hospital', '1677 Post Road East', 'Westport', 'CT', '06880', '(203) 259-3647', '', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSmall Animal Medicine & Surgery, Pocket Pets Rabbits & Wildlife, House Calls/Late Appointments, Chinese Herbs, USDA Certified Veterinarian\n'); INSERT INTO `default_table` VALUES (467, 'Save Our Strays', '1677 Post Road East', 'Westport', 'CT', '06880', '(203) 255-0514', '', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Additional Information:
\nSmall Animal Medicine & Surgery, Pocket Pets Rabbits & Wildlife, House Calls/Late Appointments, Chinese Herbs, USDA Certified Veterinarian\n'); INSERT INTO `default_table` VALUES (468, 'Hart Patricia A Dvm', '1677 Post Road East', 'Westport', 'CT', '06880', '(203) 259-3647', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (469, 'Poster Joan Vmd', '1677 Post Road East', 'Westport', 'CT', '06880', '(203) 259-3647', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPoster Animal Hospital, Small Animal Medicine & Surgery, Emergency Services Available\n'); INSERT INTO `default_table` VALUES (470, 'Poster Animal Hospital', '1677 Post Road East', 'Westport', 'CT', '06880', '(203) 255-0514', '', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (471, 'Connecticut Humane Society', '455 Post Road East', 'Westport', 'CT', '06880', '(203) 227-4137', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (472, 'Little Guild Of Saint Francis Animal Shelter', '285 Sharon Goshen Turnpike', 'West Cornwall', 'CT', '06796', '(860) 672-6346', 'http://www.littleguild.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (473, 'Animals in Distress Inc', '238 Danbury Road', 'Wilton', 'CT', '06897', '(203) 762-2006', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (474, 'Advanced Wildlife Control Llc', '67 Bunnell Street', 'Winsted', 'CT', '06098', '(860) 379-0440', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (475, 'Kent County SPCA', '32 Shelter Circle', 'Camden', 'DE', '19934', '(302) 698-3006', 'http://www.kentcountyspca.org', '', '', 'Mon-Fri 11:30-4:00 Tues Wed-Thur 11:30-600 Sat-Sun 11:30-3:00', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (476, 'Delaware SPCA Sussex Chapter', '326 South Dupont Highway', 'Georgetown', 'DE', '19947', '(302) 856-6361', 'http://www.delspca.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (477, 'MERR Institute', '801 Pilottown Road', 'Lewes', 'DE', '19958', '(302) 644-2678', '', '', '', '', ''); INSERT INTO `default_table` VALUES (478, 'Shawnee Kennels', '6729 Shawnee Road', 'Milford', 'DE', '19963', '(302) 422-2355', '', '', 'Proudly Serving Kent and Sussex Counties', '', '\nLanguages Spoken:
\n\n'); INSERT INTO `default_table` VALUES (479, 'Tri-State Bird Rescue & Research', '110 Old Possum Hollow Road', 'Newark', 'DE', '19711', '(302) 737-9543', 'http://www.tristatebird.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (480, 'Delaware Humane Association', '701 A Street', 'Wilmington', 'DE', '19801', '(302) 571-0111', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (481, 'Washington Humane Society', '7319 Georgia Ave NW', 'Washington', 'DC', '20001', '(202) 234-8626', 'http://www.washhumane.org', '', 'The Good Home Guarantee Is Our Five Year Plan To Reach A 100% Placement Rate For Adoptable Animals Entering Our Shelters By 2010.', '24 Hours A Day Animal Rescue', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPets For Adoption, Low Cost Spay-Neuter, Animal Advice, Volunteer Opportunities\n'); INSERT INTO `default_table` VALUES (482, 'Washington Humane Society', '7319 Georgia Avenue Northwest', 'Washington', 'DC', '20001', '(202) 333-4010', 'http://www.washhumane.org', '', '', '', '\nAdditional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (483, 'Alley Cat Allies', '1801 Northwest Belmont Road', 'Washington', 'DC', '20009', '(202) 667-3630', '', '', '', '', ''); INSERT INTO `default_table` VALUES (484, 'Washington Animal Rescue League & Medical Center', '71 Oglethorpe St', 'Washington', 'DC', '20011', '(202) 726-2556', 'http://www.warl.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nModern facility centrally located, 71 Oglethorpe Street, N.W., Washington, D.C. 20011\n'); INSERT INTO `default_table` VALUES (485, 'Spay-Neuter Clinic', '7319 Georgia Av NW', 'Washington', 'DC', '20011', '(202) 234-8626', 'http://www.washhumane.org', '', '', 'Tues And Thurs 12-8 Pm Sat And Sun 11-3 Pm', '\nProducts & Services:
\n\n
Additional Information:
\nPets For Adoption, Low Cost Spay-Neuter, Animal Advice, Volunteer Opportunities\n'); INSERT INTO `default_table` VALUES (486, 'Spay-Neuter Clinic', '7315 Georgia Avenue Northwest', 'Washington', 'DC', '20012', '(202) 882-5837', 'http://www.washhumane.org', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Additional Information:
\nThe Washington Humane Society, First Rate Service, At Below Cost Fees, Appointments Only, DC Residents Only\n'); INSERT INTO `default_table` VALUES (487, 'Defenders Of Wildlife', '1130 17th Northwest', 'Washington', 'DC', '20036', '(202) 682-9400', '', '', '', '', '\nAdditional Information:
\nEnvironmental Conservation & Ecological Organizations\n'); INSERT INTO `default_table` VALUES (488, 'Hsus Wildlife Land Trust', '2100 L Street Northwest', 'Washington', 'DC', '20037', '(202) 452-1100', 'http://www.hsus.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (489, 'Humane Society of the United States', '2100 L Street Northwest', 'Washington', 'DC', '20037', '(202) 452-1100', 'http://www.hsus.org', '', 'Center for the Handicapped', 'M-F 9am-5pm', '\nProducts & Services:
\n\n
Additional Information:
\nFax: (301) 258-3078\n'); INSERT INTO `default_table` VALUES (490, 'Pinellas Animal Hospital & Bird Clinic', '8490 49th St N', 'Pinellas Park', 'FL', '33602', '(813) 546-0005', 'http://www.pinellasvet.com', 'www.pinellasvet@aol.com', '', 'Monday-Wednesday 7:30Am-7:00Pm,tuesday-Thursday-Friday 7:30Am-6:00Pm,saturday 7:30Am-6:00Pm,saturday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nPinellas Animal Hospital & Bird, Senior Care, Clinic, E.C. Godfrey, D.V.M., David Elmer, D.V.M., Cherie Buisson, D.V.M., Wellness Care, Internal Medicine, Allergy & Skin Disease\n'); INSERT INTO `default_table` VALUES (491, 'S P C A Tampa Bay', '9099 130th Avenue', 'Largo', 'FL', '33773', '(727) 586-3591', 'http://www.spcatampabay.org', '', '', 'Tue-Sun: 12:00am-12:00am', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nTampa Bay''s Largest\n'); INSERT INTO `default_table` VALUES (492, 'Humane Society Of Tampa Bay', '3607 N Armenia Ave', 'Tampa', 'FL', '33607', '(813) 876-7138', 'http://humanesocietytampa.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt A Happy Healthy Shelter Pet, Fee Includes Sterilization Vaccines & Microchip\n'); INSERT INTO `default_table` VALUES (493, 'Retirement Home for Horses Inc', '20307 Northwest County Road 235A', 'Alachua', 'FL', '32615', '(386) 462-1001', '', '', '', 'Open Saturdays', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (494, 'Mill Creek Farm', '20307 Northwest County Road 235A', 'Alachua', 'FL', '32615', '(386) 462-1001', 'http://www.millcreekfarm.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (495, 'Saving Animals for Everyone', '12525 Northeast 30th Court', 'Anthony', 'FL', '32617', '(352) 671-6797', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (496, 'Canine Castaways', '5293 Northeast Masters Avenue', 'Arcadia', 'FL', '34266', '(863) 491-6888', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (497, 'Marathon Big Pine', '279 Industrial Road', 'Big Pine Key', 'FL', '33043', '(305) 872-3412', '', '', '', '', ''); INSERT INTO `default_table` VALUES (498, '10th Life Sanctuary Inc', '22238 Southwest 62nd Avenue', 'Boca Raton', 'FL', '33428', '(561) 883-2213', 'http://www.10thlifesanctuary.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (499, 'Hollydogs Greyhound Adoption', '11405 Longfellow Lane', 'Bonita Springs', 'FL', '34135', '(239) 948-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (500, 'Humane Society Of Manatee County', '2515 Tamiami Trail', 'Bradenton', 'FL', '34205', '(941) 747-8808', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (501, 'Bishop Animal Shelter SPCA of Manatee County Inc', '5718 21st Avenue West', 'Bradenton', 'FL', '34209', '(941) 792-2863', 'http://www.bishop-spca.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (502, 'Society For The Prevention Of Cruelty To Animals Of Manatee Coun', '5718 21st Avenue West', 'Bradenton', 'FL', '34209', '(941) 792-2863', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (503, 'Humane Society Of Manatee', '7505 County Road 675', 'Bradenton', 'FL', '34202', '(941) 322-9491', '', '', '', '', ''); INSERT INTO `default_table` VALUES (504, 'Animal Rescue Of West Pasco', '14945 Harmon Drive', 'Brooksville', 'FL', '34610', '(727) 856-6762', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (505, 'S P C A of Hernando County', '9075 Grant Street', 'Brooksville', 'FL', '34613', '(352) 596-7000', 'http://www.spca-bvl.petfinder.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (506, 'Society For The Prevention Of Cruel To Animals-S P C A', '9075 Grant Street', 'Brooksville', 'FL', '34613', '(352) 596-7000', 'http://www.spca-bvl.petfinder.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Additional Information:
\nA Publicly Funded All Volunteer, Loving Pets Avail For Adoption\n'); INSERT INTO `default_table` VALUES (507, 'Just A Little Shelter Horse Rescue', '401 E County Road 2006', 'Bunnell', 'FL', '32110', '(386) 586-5870', '', '', '', '', ''); INSERT INTO `default_table` VALUES (508, 'Ears Endangered Animal Rescue Sanctuary', '2615 East Highway 318', 'Citra', 'FL', '32113', '(352) 595-2959', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (509, 'Humane Society of North Pinellas', '3040 State Road 590', 'Clearwater', 'FL', '33759', '(727) 797-7722', 'http://www.hsnp.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (510, 'Nationwide Pet Protectors Inc', '2817 Gloria Court', 'Clearwater', 'FL', '33761', '(941) 723-1187', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (511, 'South Lake Animal League Thrift Shop', '770 West Montrose Street', 'Clermont', 'FL', '34711', '(352) 394-1818', 'http://www.slal.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (512, 'The 10th Life Sanctuary Inc', '16601 Sr 80', 'Clewiston', 'FL', '33440', '(863) 902-9200', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (513, 'Central Brevard Humane Society', '1020 Cox Road', 'Cocoa', 'FL', '32926', '(321) 636-3343', 'http://www.crittersavers.com', 'communityrelations@cfl.rr.com', '', 'Mon-Tue: 11:00 AM-05:00 PM
Wed-Thu: 11:00 AM-07:00 PM
Fri-Sat: 11:00 AM-05:00 PM
Sun 11:00', '\nProducts & Services:
\n\n
Brands:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (514, 'Fino Doggie Rescue Inc', '9420 Royal Palm Boulevard', 'Coral Springs', 'FL', '33065', '(954) 755-3466', '', '', '', '', ''); INSERT INTO `default_table` VALUES (515, 'Adopt A Rescued Pet', '8390 North Orangebud Terrace', 'Crystal River', 'FL', '34428', '(352) 795-9550', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (516, 'Wade''s Coin & Currency', '579 Southeast US Highway 19', 'Crystal River', 'FL', '34429', '(352) 795-9550', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (517, 'ARNI', '126 West International Speedw', 'Daytona Beach', 'FL', '32114', '(386) 267-0277', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (518, 'Greyhound Pets of America', '2483 Bellevue Avenue', 'Daytona Beach', 'FL', '32114', '(386) 323-7444', '', '', '', '', '\nAdditional Information:
\nCharitable Organizations, Animal Shelters\n'); INSERT INTO `default_table` VALUES (519, 'Halifax Humane Society', '2364 Lpga Boulevard', 'Daytona Beach', 'FL', '32124', '(386) 274-4703', 'http://www.halifaxhumanesociety.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nCompanion Animals For Adoption, Low Cost Spay/Neuter Clinic, Cruelty Investigation, 24 Hour Animal Rescue\n'); INSERT INTO `default_table` VALUES (520, 'Americas Pet Recovery System', '4 Oceans West Boulevard', 'Daytona Beach', 'FL', '32118', '(386) 761-9060', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (521, 'Feline Friends', '165 Northeast 2nd Avenue', 'Deerfield Beach', 'FL', '33441', '(954) 596-0848', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (522, 'West Volusia Humane Society Inc', '800 Humane Society Road', 'Deland', 'FL', '32720', '(386) 734-2450', 'http://www.wvhumanesociety.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (523, 'Franklin County - Animal Control', '210 Highway 65', 'Eastpoint', 'FL', '32328', '(850) 670-4733', '', '', '', '', ''); INSERT INTO `default_table` VALUES (524, 'Pet Welfare', '683 Range Road', 'Eglin Afb', 'FL', '32542', '(850) 678-5066', 'http://www.petwelfare.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (525, 'EARS Animal Rescue Sanctua', '145 West Dearborn Street', 'Englewood', 'FL', '34223', '(941) 475-0636', '', '', '', '', ''); INSERT INTO `default_table` VALUES (526, 'Animal Aid Society', '6781 San Casa Drive', 'Englewood', 'FL', '34224', '(941) 474-7884', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (527, 'Sunnybrook Animal And Bird Hospital', '4089 South Access Road', 'Englewood', 'FL', '34224', '(941) 474-6393', 'http://www.sunnybrookvet.com', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nQuality Grooming With Prompt Service, All Breed Grooming Available, Reasonable Rates, Medicated Baths, Experienced Groomer\n'); INSERT INTO `default_table` VALUES (528, 'Suncoast Humane Society', '6781 San Casa Dr', 'Englewood', 'FL', '34224', '(941) 474-7884', 'http://www.humane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (529, 'Animal Rescue Inc', '400 North Sr 29', 'Felda', 'FL', '33930', '(863) 612-0228', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (530, 'SPCA', '2070 Griffin Road', 'Fort Lauderdale', 'FL', '33312', '(954) 463-4870', '', '', '', '', ''); INSERT INTO `default_table` VALUES (531, 'Humane Society Of Broward County Inc - Animal Shelter', '2070 Griffin Road', 'Fort Lauderdale', 'FL', '33312', '(954) 463-4870', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (532, 'SPCA', '2070 Griffin Road', 'Fort Lauderdale', 'FL', '33312', '(954) 989-3977', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nDog Obedience, Spay & Neutering Services, Pet Cremation, Memorials-Bequests, Adoption Hours\n'); INSERT INTO `default_table` VALUES (533, 'Wildlife Care Center-Spca', '3200 Southwest 4th Avenue', 'Fort Lauderdale', 'FL', '33315', '(954) 524-4302', '', 'rjmeyer@bellsouth.net', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (534, 'Broward County Of', '1870 Southwest 39th Street', 'Fort Lauderdale', 'FL', '33315', '(954) 359-1313', 'http://www.broward.org/animal', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Adoptions\n'); INSERT INTO `default_table` VALUES (535, 'Kritter Kare Inc', '1244 South Federal Highway', 'Fort Lauderdale', 'FL', '33316', '(954) 764-8600', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (536, 'Lee County Animal Services', '5600 Banner Drive', 'Fort Myers', 'FL', '33912', '(239) 432-2083', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (537, 'Humane Society of Lee County Inc', '2010 Arcadia Street', 'Fort Myers', 'FL', '33916', '(239) 332-0364', 'http://www.humanesociety-leecounty.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (538, 'Animal Refuge Center Inc', '18011 Old Bayshore Road', 'Fort Myers', 'FL', '33917', '(239) 731-3535', 'http://www.animalrefuge.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (539, 'Didonato Karen', '14520 Orange Avenue', 'Fort Pierce', 'FL', '34945', '(772) 467-0400', '', '', '', '', ''); INSERT INTO `default_table` VALUES (540, 'Horse Heaven Rescue', '14520 Orange Avenue', 'Fort Pierce', 'FL', '34945', '(772) 467-0400', 'http://www.horseheavenrecue.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (541, 'Humane Society Of St Lucie Co Inc', '100 Savannah Road', 'Fort Pierce', 'FL', '34982', '(772) 461-0687', 'http://www.hsslc.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (542, 'Save Our Cats And Kittens (socks)', '498 Carmel Drive', 'Fort Walton Beach', 'FL', '32547', '(850) 863-5756', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (543, 'Humane Society of FWB', '752 Lovejoy Road Northwest', 'Fort Walton Beach', 'FL', '32548', '(850) 243-1525', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (544, 'Panhandle Animal Welfare Society', '752 Lovejoy Road Northwest', 'Fort Walton Beach', 'FL', '32548', '(850) 243-1525', 'http://www.paws-shelter.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (545, 'Ruff', '127 Miracle Strip Parkway South', 'Fort Walton Beach', 'FL', '32548', '(850) 863-7833', 'http://www.911ruff.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nRescued Unwanted Furry Friends, Specializing In Canines\n'); INSERT INTO `default_table` VALUES (546, 'North Florida Equine Ranch & Rescue Inc', '5315 South County Road 209', 'Green Cove Springs', 'FL', '32043', '(904) 284-1115', '', '', '', '', ''); INSERT INTO `default_table` VALUES (547, 'Humane Society of Broward County Inc', '2070 Griffin Road', 'Hollywood', 'FL', '33019', '(954) 989-3977', 'http://www.humanebroward.com', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDog Obedience, Spay & Neutering Services, Pet Cremation, Memorials-Bequests\n'); INSERT INTO `default_table` VALUES (548, 'Vanishing Species Inc', '7191 Harding Street', 'Hollywood', 'FL', '33024', '(954) 961-6500', 'http://www.vanishingspecies.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (549, 'Adopt A Friend For Life Humane Society', '2070 Griffin Road', 'Hollywood', 'FL', '33019', '(954) 989-3977', 'http://www.humanebroward.com', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPET ADOPTIONS, Purebreds & Mixes / All Ages\n'); INSERT INTO `default_table` VALUES (550, 'Suncoast Seabird Sanctuary Inc', '18328 Gulf Blvd', 'Indian Shores', 'FL', '33785', '(727) 391-6211', 'http://www.seabirdsanctuary.org', '', 'Nation''s Largest Wild Bird Hospital - Open Free to Public 9am Till Dark - 365 Days a Year - Donations Greatly Accepted', 'Mon-Sun: 09:00am-07:00pm', '\nProducts & Services:
\n\n
Additional Information:
\nNation''s Largest Wild Bird Hospital, We Care For Sick & Injured Wild Birds, Open Free To Public - 9 AM Till Dark, 501-C-3 Non-Profit, Donations Greatly Accepted\n'); INSERT INTO `default_table` VALUES (551, 'Humane Society Of Inverness', '2109 South Mohican Trail', 'Inverness', 'FL', '34450', '(352) 726-8801', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (552, 'Animal Care & Control Center', '2580 West 1st Street', 'Jacksonville', 'FL', '32254', '(904) 886-4375', 'http://www.jaxpets.org', '', '', '', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nMandarin Adoption Center (Adoption Only), City Of Jacksonville\n'); INSERT INTO `default_table` VALUES (553, 'Animal Care & Control Center', '2580 W 1st Street', 'Jacksonville', 'FL', '32254', '(904) 387-8924', 'http://www.jaxpets.org', '', '', '', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nMandarin Adoption Center (Adoption Only), City Of Jacksonville\n'); INSERT INTO `default_table` VALUES (554, 'Jacksonville Humane Society Animal Shelter', '8464 Beach Boulevard', 'Jacksonville', 'FL', '32216', '(904) 725-8768', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (555, 'Pet Stop Of South Florida', '550 N Military Trail Pmb 117, Ste 222', 'Jupiter', 'FL', '34994', '(772) 220-4444', 'http://www.getpetstop.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nExclusive Features, Prompt Attention, Risk Free Purchase, Money Back Guarantee, Unsurpassed Experience, We Service All Brands, Time to Trade Up?, Pet Fence Systems, Call For Details, If you can find... (Show More)\nExclusive Features, Prompt Attention, Risk Free Purchase, Money Back Guarantee, Unsurpassed Experience, We Service All Brands, Time to Trade Up?, Pet Fence Systems, Call For Details, If you can find a more advanced pet fence system We''ll buy it for you!, Your Pet''s Safety-Our #1 Concern, Free In Home Demonst  (Show Less)\n'); INSERT INTO `default_table` VALUES (556, 'North County Humane Society', '185 East Indiantown Road Suite 211', 'Jupiter', 'FL', '33477', '(561) 747-1598', '', '', '', '', '\nAdditional Information:
\nA Picture Is Worth A Thousand Words, Need We Say More About Safe Harbor, Winston Has Removed From A Home After Police Were Called To A Domestic Dispute As You Can See In The Photo On The Left The... (Show More)\nA Picture Is Worth A Thousand Words, Need We Say More About Safe Harbor, Winston Has Removed From A Home After Police Were Called To A Domestic Dispute As You Can See In The Photo On The Left The Wife And Children Were Not The Only Ones Being Abused Winston Came To Safe Harbor Weighing Only 26 Pounds, Today At 78 Pounds Winston Lives With A Wonderful Family And His Girlfriend Rosie, Ask About Our New Boarding Services, Low-Cost Spay & Neuter, Please Make Your Tax-Deductible Donations Today, To Our No Kill Animal Shelter & Hospital  (Show Less)\n'); INSERT INTO `default_table` VALUES (557, 'Safe Harbor Animal Sanctuary & Hospital', '185 East Indiantown Road', 'Jupiter', 'FL', '33477', '(561) 747-1598', 'http://www.safeharboranimalrescue.com', 'mangomaddy@aol.com', '', 'Monday-Friday 9Am-6Pm Saturday 9Am-2Pm Closed Sunday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nA Picture Is Worth A Thousand Words, Need We Say More About Safe Harbor, Winston Has Removed From A Home After Police Were Called To A Domestic Dispute As You Can See In The Photo On The Left The... (Show More)\nA Picture Is Worth A Thousand Words, Need We Say More About Safe Harbor, Winston Has Removed From A Home After Police Were Called To A Domestic Dispute As You Can See In The Photo On The Left The Wife And Children Were Not The Only Ones Being Abused Winston Came To Safe Harbor Weighing Only 26 Pounds, Today At 78 Poun  (Show Less)\n'); INSERT INTO `default_table` VALUES (558, 'Humane Animal Care Coalition', '105951 Overseas Highway', 'Key Largo', 'FL', '33037', '(305) 451-0088', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (559, 'Island Dolpin Care', '150 Lorelane Place', 'Key Largo', 'FL', '33037', '(305) 451-5884', 'http://www.islanddolphincare.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nLong Distance Telephone Service\n'); INSERT INTO `default_table` VALUES (560, 'Wildlife Rescue Of The Florida Keys', '1801 White Street', 'Key West', 'FL', '33040', '(305) 294-1441', 'http://www.seabirdsanctuary.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nProudly Owned & Operated By Suncoast Seabird Sanctuary Inc, Free Admission Visit 100 + Native Birds & Our Wooded Birders Trail, We Are Open Daily 9 AM - Dusk, Help Us Continue Our Wildlife Mission,... (Show More)\nProudly Owned & Operated By Suncoast Seabird Sanctuary Inc, Free Admission Visit 100 + Native Birds & Our Wooded Birders Trail, We Are Open Daily 9 AM - Dusk, Help Us Continue Our Wildlife Mission, Car-Boat & RV Donations Wanted, We Pick Up/Fix Up/& Retail Your Gift, We Are A 501 (C) (3)-100% Charity, Receive The Maximum  (Show Less)\n'); INSERT INTO `default_table` VALUES (561, 'Animal Shelter', '5230 College Road', 'Key West', 'FL', '33040', '(305) 294-4857', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters, Pet Shops\n'); INSERT INTO `default_table` VALUES (562, 'Florida Keys S P C A', '5230 College Road', 'Key West', 'FL', '33040', '(305) 294-4857', 'http://www.fkspca.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (563, 'SPCA', '5850 Brannen Road South', 'Lakeland', 'FL', '33813', '(863) 646-7722', 'http://www.lovemyspca.com', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nSociety for the Prevention of Cruelty to Animals, Serving All Of Central Florida, Clinic/ Wellness Center, Hours: Tues-Fri 7 am-5pm, Spay & Neuter, Vaccinations & Preventative Medicine, Walk-Ins &... (Show More)\nSociety for the Prevention of Cruelty to Animals, Serving All Of Central Florida, Clinic/ Wellness Center, Hours: Tues-Fri 7 am-5pm, Spay & Neuter, Vaccinations & Preventative Medicine, Walk-Ins & New Clients Welcome, Drop Off Service, ADOPTION CENTER, All Pets Spayed or Neutered, Vaccinations up to date, Member of National &  (Show Less)\n'); INSERT INTO `default_table` VALUES (564, 'S P C A Inc', '2102 East Edgewood', 'Lakeland', 'FL', '33803', '(863) 667-2303', '', '', '', '', ''); INSERT INTO `default_table` VALUES (565, 'Lake City Animal Shelter & Adoption Center', '1 Shelter Drive', 'Lake City', 'FL', '32024', '(386) 752-4702', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Additional Information:
\nADOPTION CENTER:, Both Facilities Closed On Holidays\n'); INSERT INTO `default_table` VALUES (566, 'Cats In The Cradle', '1125 Old Dixie Highway', 'Lake Park', 'FL', '33403', '(561) 848-6930', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nDog & Cat Kennels\n'); INSERT INTO `default_table` VALUES (567, 'Pet Motel The', '313 Hickory Hammock Rd', 'Lake Wales', 'FL', '33859', '(863) 676-5736', '', '', '', '24 Hour Personalized Care', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\n24 Hour Personalized Care, Home Of Lake Wales Animal Shelter\n'); INSERT INTO `default_table` VALUES (568, 'Pet Exchange', '4508 Drexel Road', 'Land O Lakes', 'FL', '34638', '(813) 996-4875', '', '', '', '', ''); INSERT INTO `default_table` VALUES (569, 'S P C A Tampa Bay', '9099 130th Avenue', 'Largo', 'FL', '33773', '(727) 586-3591', 'http://www.spcatampabay.org', '', '', 'Tue-Sun: 12:00am-12:00am', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nTampa Bay''s Largest\n'); INSERT INTO `default_table` VALUES (570, 'Florida Audubon Society - Gift Shop', '921 North Lake Sybelia Drive', 'Maitland', 'FL', '32751', '(407) 644-0190', 'http://www.audubon.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (571, 'Audubon Center for Birds of Prey', '1101 Audubon Way', 'Maitland', 'FL', '32751', '(407) 644-0190', 'http://www.audubon.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (572, 'Stand Up For Animals', '10600 Aviation Boulevard', 'Marathon', 'FL', '33050', '(305) 743-3779', 'http://www.sufapets.com', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (573, 'Stand Up For Animals Of Marathon', '10600 Aviation Boulevard', 'Marathon', 'FL', '33050', '(305) 743-5660', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (574, 'Animal Shelter', '10550 Aviation Boulevard', 'Marathon', 'FL', '33050', '(305) 743-5660', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (575, 'South Animal Care & Adoption Center', '5100 West Eau Gallie Boulevard', 'Melbourne', 'FL', '32934', '(321) 253-6608', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (576, 'Humane Society of South Brevard Inc', '2600 Otter Creek Lane', 'Melbourne', 'FL', '32940', '(321) 259-0601', 'http://www.brevard.petfinder.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (577, 'Humane Emergency Animal Rescue', '3171 NW 1st Street', 'Miami', 'FL', '33125', '(305) 631-8840', '', '', '', '', '\nAdditional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (578, 'Wild Cats', '266 Northeast 70th Street', 'Miami', 'FL', '33138', '(305) 756-1881', 'http://www.wildcats-inc.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (579, 'Pet Adoption Center', '2101 Northwest 95th Street', 'Miami', 'FL', '33147', '(305) 696-0800', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (580, 'S P C A Clinic', '2101 Northwest 95th Street', 'Miami', 'FL', '33147', '(305) 696-0800', '', '', '', '', ''); INSERT INTO `default_table` VALUES (581, 'Spay & Neuter Clinic', '2101 Northwest 95th Street', 'Miami', 'FL', '33147', '(305) 696-0800', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (582, 'Oaklawn Pet Cemetery Of The Humane Society Of Greater Miami', '2101 Northwest 95th Street', 'Miami', 'FL', '33147', '(305) 696-0800', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Adoptions, Low Cost Spay Neuter & Vaccinations, Dog Obedience Training, Pet Grooming\n'); INSERT INTO `default_table` VALUES (583, 'Pet Rescue', '3440 Northwest 191st Street', 'Miami Gardens', 'FL', '33056', '(305) 621-8354', 'http://www.petrescuemiami.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (584, 'Safe Animal Shelter of Orange Park Inc', '2913 County Road 220', 'Middleburg', 'FL', '32068', '(904) 276-7233', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (585, 'Jefferson County Humane Society Inc', '1250 Mamie Scott Drive', 'Monticello', 'FL', '32344', '(850) 342-0244', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (586, 'Humane Society of Collier County Inc', '370 Airport Pulling Road North', 'Naples', 'FL', '34104', '(239) 643-1555', 'http://www.collierhumanesoc.org', '', '', 'Tuesday-Saturday 10:00Am-4:30Pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt A Pet, Jet Set Pets Boutique, Specialty Collars, Designer Fashions, Decorator Bowls, Pampered Pet Beds, Gifts For Pets & Pet Lovers\n'); INSERT INTO `default_table` VALUES (587, 'The Menagerie Foundation Big Cat Sanctuary', '440 23rd Southwest', 'Naples', 'FL', '34117', '(239) 353-2717', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (588, 'Shy Wolf Sanctuary Education And Experience Center Inc', '1161 27th Street Southwest', 'Naples', 'FL', '34117', '(239) 455-1698', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (589, 'Canterbury Florida''s Equestrian Show Place', '23100 West Newberry Road', 'Newberry', 'FL', '32669', '(352) 472-6758', 'http://www.canterburyshowplace.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (590, 'SPCA Of West Pasco Inc', '7734 Congress Street', 'New Port Richey', 'FL', '34653', '(727) 849-1048', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (591, 'Adopt A Cat Thrift', '804 US Highway 1', 'North Palm Beach', 'FL', '33403', '(561) 848-6930', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (592, 'Okeechobee County Animal Control Services', '1480 Northwest 25th Drive', 'Okeechobee', 'FL', '34972', '(863) 357-3225', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (593, 'Saras Pets Care', '226 S Volusia Avenue', 'Orange City', 'FL', '32763', '(386) 775-5300', '', '', '', '', ''); INSERT INTO `default_table` VALUES (594, 'Back To Nature Wildlife Refuge', '18515 East Colonial Drive', 'Orlando', 'FL', '32820', '(407) 568-5138', 'http://www.btn-wildlife.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (595, 'Guardian Angels Pet Rescue, Inc.', '14422 Daring Avenue', 'Orlando', 'FL', '32826', '(321) 302-6939', 'http://www.guardianangelspetrescue.org', 'petrescue@cfl.rr.com', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n'); INSERT INTO `default_table` VALUES (596, 'Pet Rescue & Supply Inc', '1491 East Ste Road 434', 'Oviedo', 'FL', '32765', '(407) 359-0456', 'http://www.petrescueandsupply.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\n1st Non-Profit Retail, Pet Supply Store, proceeds Support Rescue, Pet Adoptions & Rescue, Staffed By Volunteer''s, Natural Healthy Pet Foods & Supplements\n'); INSERT INTO `default_table` VALUES (597, 'Wings Bird Sanctuary', '1800 N County Road 426', 'Oviedo', 'FL', '32765', '(407) 365-5715', '', '', '', '', ''); INSERT INTO `default_table` VALUES (598, 'Palm Beach County - For Departments Not Listed Below Call, Animal Care & Control Division', '3615 State Road 715', 'Pahokee', 'FL', '33476', '(561) 924-5656', 'http://www.pbcgov.com/pubsafety/animal/', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (599, 'Flagler Humane Society', '1 Shelter Drive', 'Palm Coast', 'FL', '32137', '(386) 445-1814', 'http://www.flagerhumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (600, 'Suncoast Animal League', '37594 Us Highway 19 North', 'Palm Harbor', 'FL', '34684', '(727) 939-1300', '', '', '', '', ''); INSERT INTO `default_table` VALUES (601, 'The Humane Society of Bay County', '1600 Bay Avenue', 'Panama City', 'FL', '32405', '(850) 763-3923', 'http://www.adoptme.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt From Us Today, Low Cost Spay & Neuter Certificates, Pet Adoptions, Microchipping Available, Volunteer Program\n'); INSERT INTO `default_table` VALUES (602, 'Stay & Play Pet Resort', '3155 North Rye Road', 'Parrish', 'FL', '34219', '(941) 776-8599', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (603, 'Humane Society', '2480 West Garden Street', 'Pensacola', 'FL', '32501', '(850) 432-4250', 'http://www.humanesocietyofpensacola.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (604, 'Animal Shelter Escambia County Of', '200 West Fairfield Drive', 'Pensacola', 'FL', '32501', '(850) 595-3075', '', '', '', '', '\nProducts & Services:
\n\n
Description:
\nConverted warehouses contain exhibits depicting Gulf Coast history.\n'); INSERT INTO `default_table` VALUES (605, 'Pinellas Animal Hospital & Bird Clinic', '8490 49th St N', 'Pinellas Park', 'FL', '33602', '(813) 546-0005', 'http://www.pinellasvet.com', 'www.pinellasvet@aol.com', '', 'Monday-Wednesday 7:30Am-7:00Pm,tuesday-Thursday-Friday 7:30Am-6:00Pm,saturday 7:30Am-6:00Pm,saturday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nPinellas Animal Hospital & Bird, Senior Care, Clinic, E.C. Godfrey, D.V.M., David Elmer, D.V.M., Cherie Buisson, D.V.M., Wellness Care, Internal Medicine, Allergy & Skin Disease\n'); INSERT INTO `default_table` VALUES (606, 'Paso Fino Horse Association', '101 North Collins Street', 'Plant City', 'FL', '33563', '(813) 719-7777', 'http://www.pfha.org', 'pasofino@chugach.net', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (607, 'Dog''s & Cats Forever', '9550 Carlton Road', 'Port Saint Lucie', 'FL', '34987', '(772) 489-5454', 'http://www.dogsandcatsforever.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (608, 'Peace River Wildlife Center Inc', '3400 West Marion Avenue', 'Punta Gorda', 'FL', '33950', '(941) 637-3830', 'http://www.peaceriverwildlifecenter.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (609, 'Animal Control', '1510 Selman Road', 'Quincy', 'FL', '32351', '(850) 875-4979', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (610, 'Care Inc', '1528 27th Street Southeast', 'Ruskin', 'FL', '33570', '(813) 645-2273', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (611, 'Heath Ralph T', '18328 Gulf Boulevard', 'Saint Petersburg', 'FL', '33708', '(727) 391-6211', 'http://www.seabirdsanctuary.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nWe Care For Sick & Injured Wild Birds, Open 9 AM Till Dark, 7 Days A Week, Open To Public-Free Admission\n'); INSERT INTO `default_table` VALUES (612, 'Greyhounds Pets Of America', '10490 Gandy North', 'Saint Petersburg', 'FL', '33702', '(727) 576-8547', '', '', '', '', ''); INSERT INTO `default_table` VALUES (613, 'Pet Pal Rescue', '405 22nd Street South', 'Saint Petersburg', 'FL', '33712', '(727) 328-7738', '', '', '', 'Tue-Fri: 11:00 AM-04:30 PM
Sat 10:00 AM-04:30 PM', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (614, 'Acme Grooming Co. And Pet Haven Adoption Service', '732 S Us Highway 17', 'San Mateo', 'FL', '32187', '(386) 328-9833', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nWe Groom All Your Pets, 4 STAR, RATING\n'); INSERT INTO `default_table` VALUES (615, 'Pelican Man Bird Sanctuary', '1708 Ken Thompson Pkwy', 'Sarasota', 'FL', '34236', '(941) 388-4444', 'http://www.pelicanman.org', '', 'Bird and Mammal Wildlife Rescue and Rehabilitation.', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nWe Groom All Your Pets, 4 STAR, RATING\n'); INSERT INTO `default_table` VALUES (616, 'Humane Society Of Sarasota County Inc', '2331 15th Street', 'Sarasota', 'FL', '34237', '(941) 955-4131', 'http://www.hssc.org', 'lost@floridapetpages.com', 'Human Society', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nHumane Society of Sarasota, County Inc, HUMANE SOCIETY OF, SARASOTA COUNTY, INC., A private, non-profit organization, Low Cost Spay/Neuter Program\n'); INSERT INTO `default_table` VALUES (617, 'Wrede David', '4900 Wilderness Trail', 'Sebring', 'FL', '33875', '(863) 385-2770', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (618, 'Wrede''s Wildlife & Rehabilitation Center Inc', '4900 Wilderness Trail', 'Sebring', 'FL', '33875', '(863) 385-2770', 'http://www.wredeswildlife.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (619, 'Falcon Answering Service', '4900 Wilderness Trail', 'Sebring', 'FL', '33875', '(863) 385-2770', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (620, 'Cat Protection Society', '31218 Margie Owens Road', 'Sorrento', 'FL', '32776', '(352) 735-2287', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (621, 'Sandy''s Pet Care', '9999 Summerbreeze Dr.', 'Sunrise', 'FL', '33322', '(954) 292-4983', '', 'SandysPetCare@Gmail.com', '', '', '\nPayment Options:
\n\n
Languages Spoken:
\n\n'); INSERT INTO `default_table` VALUES (622, 'Animal Shelter - Tallahassee-Leon Community, Adoption Control, Animal Service Center', '1125 Easterwood Drive', 'Tallahassee', 'FL', '32311', '(850) 891-2950', '', '', '', '', ''); INSERT INTO `default_table` VALUES (623, 'Tallahassee City - Neighborhood & Community Services, Animal Shelter, Tallahassee-Leon Community', '1125 Easterwood Drive', 'Tallahassee', 'FL', '32311', '(850) 891-2950', '', '', '', '', ''); INSERT INTO `default_table` VALUES (624, 'Humane Society Of Tampa Bay', '3607 N Armenia Ave', 'Tampa', 'FL', '33607', '(813) 876-7138', 'http://humanesocietytampa.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt A Happy Healthy Shelter Pet, Fee Includes Sterilization Vaccines & Microchip\n'); INSERT INTO `default_table` VALUES (625, 'Tampa Horse Sales', '10006 East Fowler Avenue', 'Thonotosassa', 'FL', '33592', '(813) 986-1445', 'http://www.tampahorsesales.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (626, 'SPCA of North Brevard Adoption Center', '455 Cheney Highway', 'Titusville', 'FL', '32780', '(321) 267-8221', 'http://www.petfinder.com', '', '', 'Tues-Fri 10:00Am-5:00Pm,saturday 10:00Am-3:00Pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nCompanion Animals\n'); INSERT INTO `default_table` VALUES (627, 'Brevard County - North Animal Care Center', '1605 Flake Road', 'Titusville', 'FL', '32780', '(321) 264-5119', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (628, 'The Wildlife Center Of Venice', '3252 Border Road', 'Venice', 'FL', '34292', '(941) 484-9657', '', '', '', '', ''); INSERT INTO `default_table` VALUES (629, 'Humane Society - Receiving Lost & Found', '6230 77th Street', 'Vero Beach', 'FL', '32967', '(772) 388-4592', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nFind A Friend For Life, All Breeds & Types, All Pets Sterilized & Microchipped, Healthy Well Socialized Pets, Individual Counseling On Pet Care, Pet Behavior Help, Come Visit The Adoption Center,... (Show More)\nFind A Friend For Life, All Breeds & Types, All Pets Sterilized & Microchipped, Healthy Well Socialized Pets, Individual Counseling On Pet Care, Pet Behavior Help, Come Visit The Adoption Center, Please Call For Directions & Information  (Show Less)\n'); INSERT INTO `default_table` VALUES (630, 'Humane Society', '6230 77th Street', 'Vero Beach', 'FL', '32967', '(772) 388-3331', '', '', '', '6 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nFind A Friend For Life, All Breeds & Types, All Pets Sterilized & Microchipped, Healthy Well Socialized Pets, Individual Counseling On Pet Care, Pet Behavior Help, Come Visit The Adoption Center,... (Show More)\nFind A Friend For Life, All Breeds & Types, All Pets Sterilized & Microchipped, Healthy Well Socialized Pets, Individual Counseling On Pet Care, Pet Behavior Help, Come Visit The Adoption Center, Please Call For Directions & Information  (Show Less)\n'); INSERT INTO `default_table` VALUES (631, 'Humane Society', '6230 77th Street', 'Vero Beach', 'FL', '32967', '(772) 567-2309', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (632, 'Humane Society Of Greater Miami', '17425 Southwest 97th Avenue', 'Village Of Palmetto Bay', 'FL', '33157', '(305) 696-0800', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Adoptions, Low Cost Spay Neuter & Vaccinations, Dog Obedience Training, Pet Grooming\n'); INSERT INTO `default_table` VALUES (633, 'Greenman''s Glen Animal Sanctuary Inc', '12470 Kittiwake Road', 'Weeki Wachee', 'FL', '34614', '(352) 597-8711', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (634, 'PEGGY ADAMS ANIMAL RESCUE LEAGUE', '3200 North Military Trail', 'West Palm Beach', 'FL', '33409', '(561) 686-3663', 'http://www.hspb.org', '', 'ADOPTION & RECEIVING PROGRAMS & SERVICES', 'Tue-Sun: 10:00am-04:00pm', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n
Additional Information:
\nLow Cost Spay & Neuter Clinics, Adoption & Receiving Programs, Rabies Clinic - Lost & Found\n'); INSERT INTO `default_table` VALUES (635, 'Palm Beach County Humane Society', '3200 North Military Trail', 'West Palm Beach', 'FL', '33409', '(561) 686-3663', 'http://www.hspb.org', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (636, 'Greyhound Pets of America', '7047 Belvedere Road', 'West Palm Beach', 'FL', '33411', '(561) 478-3006', 'http://www.gpa-cnhc.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nCharitable Organizations, Animal Shelters\n'); INSERT INTO `default_table` VALUES (637, 'Palm Beach County - Animal Care & Control Division', '7100 Belvedere Road', 'West Palm Beach', 'FL', '33411', '(561) 233-1200', 'http://www.pbcgov.com/pubsafety/animal/', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (638, 'Animal Shelter Thrift Shop', '1015 South Dillard Street', 'Winter Garden', 'FL', '34787', '(407) 877-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (639, 'Humane Society of Polk County', '555 Sage Road', 'Winter Haven', 'FL', '33881', '(863) 324-5227', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nHumane Societies\n'); INSERT INTO `default_table` VALUES (640, 'Audubon Of Fl Natl Center For Birds Of Prey', '921 South Lake Sybelia Drive', 'Winter Park', 'FL', '32789', '(407) 644-0190', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (641, 'Albany Humane Society', '1705 West Oakridge Drive', 'Albany', 'GA', '31707', '(229) 888-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (642, 'Humane Society', '399 Beaverdam Road Extension', 'Athens', 'GA', '30605', '(706) 353-2287', 'http://www.athenshumanesociety.com', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Additional Information:
\nSave A Life - Adopt A New Best Friend\n'); INSERT INTO `default_table` VALUES (643, 'Piedmont Bark', '501 Amsterdam Avenue Northeast', 'Atlanta', 'GA', '30306', '(404) 873-5400', 'http://www.piedmontbark.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (644, 'Northside Animal Hospital', '6817 Peachtree Industrial', 'Atlanta', 'GA', '30360', '(770) 448-8910', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nVeterinarians\n'); INSERT INTO `default_table` VALUES (645, 'Barnesville Animal Shelter', '300 Mill Street', 'Barnesville', 'GA', '30204', '(770) 358-1087', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (646, 'Gordon County - Animal Shelter', '790 Harris Beamer Road Southwest', 'Calhoun', 'GA', '30701', '(706) 629-3327', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (647, 'Walker County Animal Shelter', '5118 North Marble Top Road', 'Chickamauga', 'GA', '30707', '(706) 375-2100', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (648, 'Animal Shelter', '4231 Toccoa Highway', 'Clarkesville', 'GA', '30523', '(706) 754-3533', '', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (649, 'Paws Columbus Adoption Center', '7110 Sacerdote Lane', 'Columbus', 'GA', '31907', '(706) 568-3040', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (650, 'Paws Columbus', '5734 Windsor Drive', 'Columbus', 'GA', '31909', '(706) 565-0035', 'http://www.pawscolumbus.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (651, 'Cordele Animal Shelter', '701 North 15th Street', 'Cordele', 'GA', '31015', '(229) 276-2547', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (652, 'Forsyth County Animal Shelter', '1902 Old Atlanta Road', 'Cumming', 'GA', '30041', '(770) 888-2500', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (653, 'Lumpkin Co Animal Shelter', '1363 Red Oak Flats Road', 'Dahlonega', 'GA', '30533', '(706) 867-7297', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (654, 'Whitfield County Offices - Animal Facilities', '172 Gillespie Drive', 'Dalton', 'GA', '30721', '(706) 278-2018', '', '', '', '', ''); INSERT INTO `default_table` VALUES (655, 'Whitfield County Dog Pound', '172 Gillespie Drive', 'Dalton', 'GA', '30721', '(706) 278-2018', '', '', '', '', ''); INSERT INTO `default_table` VALUES (656, 'Madison Oglethorpe Animal Shelter', '1888 Colbert Danielsville', 'Danielsville', 'GA', '30633', '(706) 795-2868', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (657, 'Club Canine', '3496 Lakeshore Drive', 'Douglasville', 'GA', '30133', '(404) 275-7446', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nOwn Room & Yard, A Four Paw Establishment At Reasonable Rates\n'); INSERT INTO `default_table` VALUES (658, 'Coffee County - Animal Control', '941 Mahogany Road', 'Douglas', 'GA', '31533', '(912) 383-8075', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (659, 'Laurens County Animal Control', '650 County Farm Road', 'Dublin', 'GA', '31021', '(478) 277-2943', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (660, 'Humane Society', '618 Firetower Road', 'Dublin', 'GA', '31021', '(478) 272-5341', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (661, 'Putnam County Animal Control', '107 Ridley Drive', 'Eatonton', 'GA', '31024', '(706) 485-3970', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (662, 'Fayette County Animal Shelter', '1 Center Drive', 'Fayetteville', 'GA', '30214', '(770) 716-4330', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (663, 'Morning Star Animal Shelter Inc', '10247 Ga Highway 116', 'Hamilton', 'GA', '31811', '(706) 628-0007', '', '', '', '', ''); INSERT INTO `default_table` VALUES (664, 'Big Canoe Animal Rescue', '55 Maintenance Road', 'Jasper', 'GA', '30143', '(706) 268-1346', 'http://www.bigcanoehoa.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (665, 'Lagrange City - Frequently Called Numbers, Other Departments, Animal Shelter', '376 Aerotron Parkway', 'Lagrange', 'GA', '30240', '(706) 883-7879', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (666, 'North East Georgia Animal Shelter', '870 Bear Creek Road', 'Lavonia', 'GA', '30553', '(706) 356-5363', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (667, 'Good Mews Animal Foundation Inc', '736 Johnson Ferry Road, Suite A-3', 'Marietta', 'GA', '30068', '(770) 499-2287', 'http://www.goodmews.org', 'info@GoodMews.org', '', '', '\nProducts & Services:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nA non-profit no-kill cage free shelter. Adoptions Saturdays 10-4 and by appointment.\n'); INSERT INTO `default_table` VALUES (668, 'Henry County - Animal Shelter', '507 Hampton Road', 'Mcdonough', 'GA', '30253', '(770) 954-2100', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (669, 'Harris County Animal Shelter', '10247 Highway 116', 'Pine Mountain Valley', 'GA', '31823', '(706) 628-4000', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (670, 'City of Quitman Animal Shelter', '800 North Highland Road', 'Quitman', 'GA', '31643', '(229) 605-9810', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (671, 'Woodmen Of The World Life Insurance', '152 South Main Street', 'Reidsville', 'GA', '30453', '(912) 557-3221', '', '', '', '', ''); INSERT INTO `default_table` VALUES (672, 'Catoosa Citizens for Animal Care Inc', '348 Oak Tree Road', 'Ringgold', 'GA', '30736', '(706) 937-2287', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (673, 'Safe Haven Ranch LLC Adopt A Pet', '58 Safehaven Road', 'Rising Fawn', 'GA', '30738', '(706) 398-0978', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (674, 'Sterile Feral Inc', '722 Kingston Avenue Northeast', 'Rome', 'GA', '30161', '(706) 232-2418', 'http://www.thesterileferal.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (675, 'Southern Hope Humane Society', '900 Mansell Road', 'Roswell', 'GA', '30076', '(770) 641-1211', 'http://www.southernhope.org', '', '', 'Weekday Through Sunday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nHumane Options To Prevent Euthanasia, Roswell Pet Adoption Center, Photos Online At wwwsouthernhopeorg, Lots Of Great Pets For Adoption, Pure Breeds, Mixed Breeds, Dogs - $85, Cats - $65, Adoption... (Show More)\nHumane Options To Prevent Euthanasia, Roswell Pet Adoption Center, Photos Online At wwwsouthernhopeorg, Lots Of Great Pets For Adoption, Pure Breeds, Mixed Breeds, Dogs - $85, Cats - $65, Adoption Fee Includes Spay/Neuter Vaccines Worming Microchip Collar & Leash (Dogs) Carrier (Cats) ID Tag And B  (Show Less)\n'); INSERT INTO `default_table` VALUES (676, 'Roswell Pet Adoption Center', '900 Mansell Road', 'Roswell', 'GA', '30076', '(770) 641-1211', 'http://www.southernhope.org', '', '', 'Weekday Through Sunday', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (677, 'Humana Inc', '123 Natures Bounty', 'Saint Marys', 'GA', '31558', '(912) 576-7390', '', '', '', '', ''); INSERT INTO `default_table` VALUES (678, 'Sandersville Animal Control Shelter City Of', '430 Beck Boulevard', 'Sandersville', 'GA', '31082', '(478) 552-2756', 'http://www.sandersville.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (679, 'Smithgall Woods Animal Shelter', '4823 Highway 75 North', 'Sautee Nacoochee', 'GA', '30571', '(706) 865-4135', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (680, 'Smithgall Charles Humane Socitey Inc', '4823 Highway 75 North', 'Sautee Nacoochee', 'GA', '30571', '(706) 865-4135', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (681, 'Humane Society', '7215 Sallie Mood Drive', 'Savannah', 'GA', '31406', '(912) 354-9515', 'http://www.savannah-humane.com', '', '', '', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nLoving Pets In Need Of Caring Homes, Full Pet Health Package Included With Every Adoption\n'); INSERT INTO `default_table` VALUES (682, 'Georgia Equine Rescue League', '156 Clarke Avenue', 'Social Circle', 'GA', '30025', '(770) 464-0138', 'http://www.gerlltd.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (683, 'Lookout Mountain Animal Resources Inc', '5871 Trion Teloga Road', 'Summerville', 'GA', '30747', '(706) 734-0812', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (684, 'Lmar Spay Neuter Clinic', '5871 Trion Teloga Road', 'Summerville', 'GA', '30747', '(706) 734-0812', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (685, 'Lmar Grooming And Boarding', '5871 Trion Teloga Road', 'Summerville', 'GA', '30747', '(706) 734-0812', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (686, 'Swainsboro City - Animal Shelter', '357 Market Street', 'Swainsboro', 'GA', '30401', '(478) 237-4040', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (687, 'Humane Societies', '180 Big Star Drive', 'Thomasville', 'GA', '31757', '(229) 228-0613', '', '', '', '', ''); INSERT INTO `default_table` VALUES (688, 'Thomasville-Thomas County Animal Shelter', '180 Big Star Drive', 'Thomasville', 'GA', '31757', '(229) 228-0613', '', '', '', '', ''); INSERT INTO `default_table` VALUES (689, 'Tift County - Animal Control', '278 Ga Highway 125 South', 'Tifton', 'GA', '31794', '(229) 382-7387', 'http://www.tiftcounty.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (690, 'Boggs Mtn Humane Shelter Inc', '261 East Boen Creek Road', 'Tiger', 'GA', '30576', '(706) 782-5422', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (691, 'Valdosta City - Animal Shelter', '2110 Cypress Street', 'Valdosta', 'GA', '31601', '(229) 245-5253', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (692, 'Lowndes County - Animal Shelter', '337 Gl Hrbn Indstrl Boulevard', 'Valdosta', 'GA', '31601', '(229) 671-2760', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (693, 'Washington Wilkes Animal Shelter', '358 Brown Road', 'Washington', 'GA', '30673', '(706) 678-2287', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (694, 'Animal Shelter', '199 Frontage Road', 'Blackfoot', 'ID', '83221', '(208) 785-6897', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (695, 'Northwest Animal Companions', '4401 Kootenai Street', 'Boise', 'ID', '83702', '(208) 429-6600', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (696, 'Animals In Distress Bird Center', '4650 North 36th Street', 'Boise', 'ID', '83703', '(208) 338-0897', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (697, 'Animal Shelter', '4775 West Dorman Street', 'Boise', 'ID', '83705', '(208) 342-3508', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nThe Biggest & Best Selection Of Kittens Puppies Dogs & Cats In The Area, Often Pre-Trained, Purebreds Available, On-Site Veterinary Clinic\n'); INSERT INTO `default_table` VALUES (698, 'Animals In Distress Association Inc', '2201 West Boise Avenue', 'Boise', 'ID', '83706', '(208) 367-1026', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (699, 'Simply Cats Formerly Just Strays', '200 North Cloverdale Road', 'Boise', 'ID', '83713', '(208) 343-7177', 'http://www.simplycats.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nThe Treasure Valley''s Only Cageless On-Kill Shelter Devoted Simply To Cats, Included In The Adoption Fee, All Vaccines, Microchip, Spray Or Neuter, Health Guaranteed, Be The Love Of 9 Lives-Adopt A... (Show More)\nThe Treasure Valley''s Only Cageless On-Kill Shelter Devoted Simply To Cats, Included In The Adoption Fee, All Vaccines, Microchip, Spray Or Neuter, Health Guaranteed, Be The Love Of 9 Lives-Adopt A Shelter Cat  (Show Less)\n'); INSERT INTO `default_table` VALUES (700, 'Buhl Animal Shelter Inc', '201 11th Avenue North', 'Buhl', 'ID', '83316', '(208) 543-4326', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (701, 'Humane Society of Teton Valley', '185 East 25 North', 'Driggs', 'ID', '83422', '(208) 354-3499', 'http://www.tetonvalleyhumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (702, 'Pet Adoption League', '1526 North Washington Avenue', 'Emmett', 'ID', '83617', '(208) 365-1359', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (703, 'The Emmett Ferret Shelter', '6034 Hillview Road', 'Emmett', 'ID', '83617', '(208) 398-8244', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (704, 'Sheena Foundation', '3893 North 2250 East', 'Filer', 'ID', '83328', '(208) 326-3266', 'http://www.sheenafoundation.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (705, '2nd Chance Pet Adoption', '1708 Highway 95', 'Fruitland', 'ID', '83619', '(208) 452-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (706, 'Camas Prairie Animal Shelter Inc', '1 Box 37 Fenn Road', 'Grangeville', 'ID', '83530', '(208) 962-3634', '', '', '', '', ''); INSERT INTO `default_table` VALUES (707, 'Animal Shelter Of The Wood River Valley', '100 Croy Creek Road', 'Hailey', 'ID', '83333', '(208) 788-4351', 'http://www.animalshelterwrv.org', '', '', 'Closed Mondays', '\nProducts & Services:
\n\n
Additional Information:
\nThe Mission Of The Animal Shelter Of The Wood River Valley Is, To Protect, Animals From Neglect Abuse And Exploitation, To Adopt, Animals To Qualified Homes, To Reduce, Pet Over - Population Through... (Show More)\nThe Mission Of The Animal Shelter Of The Wood River Valley Is, To Protect, Animals From Neglect Abuse And Exploitation, To Adopt, Animals To Qualified Homes, To Reduce, Pet Over - Population Through Education & An Active Spay/Neuter Program, To Advocate, For Heir Welfare Through Programs & Services That Mutually Benefit An  (Show Less)\n'); INSERT INTO `default_table` VALUES (708, 'Animal Shelter', '11600 North Ramsey Road', 'Hayden', 'ID', '83835', '(208) 772-4019', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (709, 'Kootenai Humane Society Pet Adoption Center', '11600 N Ramsey Road', 'Hayden', 'ID', '83835', '(208) 772-1019', '', '', '', '', ''); INSERT INTO `default_table` VALUES (710, 'Humane Society', '6 Shelter Road', 'Lewiston', 'ID', '83501', '(208) 746-1623', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (711, 'McPaws', '831 South 3rd Street', 'Mccall', 'ID', '83638', '(208) 634-3647', '', '', '', '', ''); INSERT INTO `default_table` VALUES (712, 'Humane Society', '2019 East White Avenue', 'Moscow', 'ID', '83843', '(208) 883-1166', 'http://www.humanesocietyofthepalouse.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (713, 'U S Government Offices - Interior Department of The, Fish & Wildlife Service', '13751 Upper Embankment Road', 'Nampa', 'ID', '83686', '(208) 467-9278', 'http://www.firstgov.gov', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\n5 miles SW off I-84.\nDescription:
\nThousands of migratory waterfowl pause at this 10,500-acre refuge while on their journey (Oct-Dec). Wildlife observation. Fishing, hunting in season. Visitor center (Mon-Fri, closed holidays).\n'); INSERT INTO `default_table` VALUES (714, 'United States Government - Fish & Wildlife Service, Deer Flat National Wildlife Refuge', '13751 Upper Embankment Road', 'Nampa', 'ID', '83686', '(208) 467-9278', 'http://www.firstgov.gov', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\n5 miles SW off I-84.\nDescription:
\nThousands of migratory waterfowl pause at this 10,500-acre refuge while on their journey (Oct-Dec). Wildlife observation. Fishing, hunting in season. Visitor center (Mon-Fri, closed holidays).\n'); INSERT INTO `default_table` VALUES (715, 'Noah''s Exotic Wildlife Shelter', '21595 West Highway 53', 'Rathdrum', 'ID', '83858', '(208) 687-1762', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (716, 'Great Cats of Idaho', '21595 West Highway 53', 'Rathdrum', 'ID', '83858', '(208) 687-1762', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (717, 'Animal Shelter', '958 Vfw Drive', 'Salmon', 'ID', '83467', '(208) 756-4100', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (718, 'Panhandle Animal Shelter', '1604 Great Northern Road', 'Sandpoint', 'ID', '83864', '(208) 265-7297', 'http://www.panhandleanimalshelter.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (719, 'Kay''s Animal Shelter', '2705 North Arlington Heights Road', 'Arlington Heights', 'IL', '60004', '(847) 259-2907', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (720, 'Shelter Inc', '120 West Eastman Street Suite 105', 'Arlington Heights', 'IL', '60004', '(847) 222-0341', 'http://www.shelter-inc.org', '', '', '', '\nAdditional Information:
\nHumane Societies, Social Service Organizations, Animal Shelters\n'); INSERT INTO `default_table` VALUES (721, 'Shelter Inc', '1616 N Arlington Heights Road', 'Arlington Heights', 'IL', '60004', '(847) 255-4988', '', '', '', '', ''); INSERT INTO `default_table` VALUES (722, 'Arlington Cat Clinic', '841 North Wilke Road', 'Arlington Heights', 'IL', '60005', '(847) 398-3355', '', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nQuality Healthcare For Your Cat, Well Cat Care Surgery, Ultrasound, Food & Supplies, Serving The Northwest Community Since 1988\n'); INSERT INTO `default_table` VALUES (723, 'Animal Control-City Of Aurora', '600 South River Street', 'Aurora', 'IL', '60506', '(630) 897-5695', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (724, 'Animal House Shelter', '206 Otis Road', 'Barrington', 'IL', '60010', '(847) 977-2066', 'http://www.animalhouseshelter.com', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nRescue Your Next Puppy Kitten Dog Or Cat, All Dogs & Cats Are Microchipped, Please Visit Our Website For Directions At wwwAnimalhouseSheltercom\n'); INSERT INTO `default_table` VALUES (725, 'Help For Animals', '1427 Orion Road', 'Batavia', 'IL', '60510', '(630) 879-8500', 'http://www.helpinganimals.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (726, 'Homes For Endangered And Lost Pets', '1427 Orion Road', 'Batavia', 'IL', '60510', '(630) 879-8500', 'http://www.helpinganimals.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (727, 'Pet Rescue Inc', '151 North Bloomingdale Road', 'Bloomingdale', 'IL', '60108', '(630) 893-0030', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (728, 'Bolingbrook Village - You May Dial Direct To The Following Departments, Animal Shelter', '145 Royce Road', 'Bolingbrook', 'IL', '60440', '(630) 759-0332', 'http://www.bolingbrook.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (729, 'New Beginnings For Cats', '7701 East 3500N Road', 'Bourbonnais', 'IL', '60914', '(815) 472-4734', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (730, 'Save A Golden', '1084 Hyannis Circle', 'Carol Stream', 'IL', '60188', '(630) 372-7010', '', '', '', '', ''); INSERT INTO `default_table` VALUES (731, 'My Mathews House', '2059 E County Road 1400', 'Carthage', 'IL', '62321', '(217) 357-9123', '', '', '', '', ''); INSERT INTO `default_table` VALUES (732, 'Hearts Of Hancock Humane Society', '1587 N County Road 1750', 'Carthage', 'IL', '62321', '(217) 357-3981', '', '', '', '', ''); INSERT INTO `default_table` VALUES (733, 'Prairieland Anti-Cruelty Spay Neuter Program', '2173 County Road 750 East', 'Champaign', 'IL', '61822', '(217) 586-6616', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (734, 'Coles County Animal Shelter', '6818 North County Road 1120E', 'Charleston', 'IL', '61920', '(217) 345-4112', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (735, 'Chi-Town Dog House', '2231 W. Belmont Ave.', 'Chicago', 'IL', '60618', '(773) 348-9663', 'http://www.chitowndoghouse.com', 'info@chitowndoghouse.com', '', 'Mon-Sun: 07:00 AM-07:00 PM', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Certification & Affiliations:
\n\n'); INSERT INTO `default_table` VALUES (736, 'Paws Chicago Spay-Neuter Clinic', '3516 West 26th Street', 'Chicago', 'IL', '60623', '(773) 521-7729', 'http://www.pawschicago.org', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Additional Information:
\nLurie Family Spay/Neuter Clinic\n'); INSERT INTO `default_table` VALUES (737, 'Red Door Animal Shelter', '2410 West Lunt Avenue', 'Chicago', 'IL', '60645', '(773) 764-2242', 'http://www.reddoorshelter.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (738, 'Cute Pet Adoptions', '2223 North Sawyer Avenue', 'Chicago', 'IL', '60647', '(773) 486-9548', 'http://www.cutepetadoptions.org', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nHumane Societies\n'); INSERT INTO `default_table` VALUES (739, 'Hunting Hurts', '2223 North Sawyer Avenue', 'Chicago', 'IL', '60647', '(773) 486-9548', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (740, 'Shelter Alternatives Network', '2223 North Sawyer Avenue', 'Chicago', 'IL', '60647', '(773) 486-9548', 'http://www.huntthemover.com', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nHome And Office, Packing & Storage Available, Quality Local & Long Distance Moves, ILL CC 22772 MC-CR, ICC 290640, Call For A Free Estimate\n'); INSERT INTO `default_table` VALUES (741, 'Fresh Start', '942 N Waller Avenue', 'Chicago', 'IL', '60651', '(773) 287-1169', '', '', '', '', ''); INSERT INTO `default_table` VALUES (742, 'Animal Care & Control City Of Chicago', '2741 S Western Avenue', 'Chicago', 'IL', '60608', '(312) 744-5000', '', '', '', '', ''); INSERT INTO `default_table` VALUES (743, 'Realities Supportive Services', '6239 S Winchester Avenue', 'Chicago', 'IL', '60636', '(773) 436-4966', '', '', '', '', ''); INSERT INTO `default_table` VALUES (744, 'Chicago Humane Society', '2229 North Sawyer Avenue', 'Chicago', 'IL', '60647', '(773) 486-9548', 'http://www.huntthemover.com', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nHome And Office, Packing & Storage Available, Quality Local & Long Distance Moves, ILL CC 22772 MC-CR, ICC 290640, Call For A Free Estimate\n'); INSERT INTO `default_table` VALUES (745, 'Howards Haven For Homeless And Abused Children', '2760 W 111th Street', 'Chicago', 'IL', '60655', '(773) 238-1661', '', '', '', '', ''); INSERT INTO `default_table` VALUES (746, 'The Anti-Cruelty Society', '510 North La Salle Drive', 'Chicago', 'IL', '60610', '(312) 644-8338', 'http://www.anticruelty.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nWho Loves You Baby, The Anti-Cruelty Society, We Offer, Spay/Neuter, Pet Adoptions, Free Behavior Hotline, Dog Training Classes, Free Education Programs, Volunteer Opportunities, Rehabilitation &... (Show More)\nWho Loves You Baby, The Anti-Cruelty Society, We Offer, Spay/Neuter, Pet Adoptions, Free Behavior Hotline, Dog Training Classes, Free Education Programs, Volunteer Opportunities, Rehabilitation & Treatment Of Homeless Animals, And Have Free Parking In Our Garage On Wells, A Commitment To Caring Since 18  (Show Less)\n'); INSERT INTO `default_table` VALUES (747, 'Paws Chicago', '2337 North Clark Street', 'Chicago', 'IL', '60614', '(773) 935-7297', 'http://www.pawschicago.org', '', '', '', '\nAdditional Information:
\nLurie Family Spay/Neuter Clinic\n'); INSERT INTO `default_table` VALUES (748, 'Hull House Center For Arts And Culture', '1136 W Wilson Avenue', 'Chicago', 'IL', '60640', '(773) 907-9403', '', '', '', '', ''); INSERT INTO `default_table` VALUES (749, 'Ounce Of Prevention Fund', '4859 South Wabash Avenue', 'Chicago', 'IL', '60615', '(773) 373-8670', 'http://www.ounceofprevention.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (750, 'McKinley Family Services', '2938 E 91st Street', 'Chicago', 'IL', '60617', '(773) 734-0941', '', '', '', '', ''); INSERT INTO `default_table` VALUES (751, 'Waterfalls', '236 W 109th Place', 'Chicago', 'IL', '60628', '(773) 568-3873', '', '', '', '', ''); INSERT INTO `default_table` VALUES (752, 'Iman Group Home', '10712 S State Street', 'Chicago', 'IL', '60628', '(773) 785-0109', '', '', '', '', ''); INSERT INTO `default_table` VALUES (753, 'Animal Welfare League', '6224 South Wabash Avenue', 'Chicago', 'IL', '60637', '(773) 667-0088', 'http://www.animalwelfareleague.com', 'info@animalwelfareleague.com', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (754, 'Park Forest Animal Clinic', '2348 Western Avenue', 'Chicago Heights', 'IL', '60411', '(708) 748-0022', '', '', '', '24 Hour Service', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nMobile Pet Clinic, We Come To You, House Calls Welcome, Pet Food & Supplies, Cremation Services, We Welcome New Clients, The Veterinarian\n'); INSERT INTO `default_table` VALUES (755, 'South Suburban Humane Society - Shelter', '1103 West End Avenue', 'Chicago Heights', 'IL', '60411', '(708) 755-7387', 'http://www.sshspets.org', 'sshs@sshspets.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (756, 'Animal Welfare League', '10305 Southwest Highway', 'Chicago Ridge', 'IL', '60415', '(708) 636-8586', 'http://www.animalwelfareleague.com', 'info@animalwelfareleague.com', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nGive A Pet A 2nd Chance At Life, Dogs-Cats-All Ages/Breeds\n'); INSERT INTO `default_table` VALUES (757, 'Vetgate USA', '119 S Main S', 'Columbia', 'IL', '62236', '(618) 281-2677', 'http://www.vetgateusa.com', 'jbrown@vetgateusa.com', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nAnimal Specialties NEC\n'); INSERT INTO `default_table` VALUES (758, 'Cairn Terrier Rescue', '8603 Route 14', 'Crystal Lake', 'IL', '60012', '(815) 459-4144', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (759, 'A Plus Boarding Grooming & Training', '8603 Ushighway 14', 'Crystal Lake', 'IL', '60014', '(815) 459-4144', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (760, 'Fox Valley Helping Paws Anima L Welfare Association', '257 King Street', 'Crystal Lake', 'IL', '60014', '(815) 459-2641', 'http://www.helpingpaws.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (761, 'Animal Emergency Clinic', '1095 Pingree Road', 'Crystal Lake', 'IL', '60014', '(815) 479-9119', '', '', '', '24 Hours a Day', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nAnd Critical Care, Open When Most Veterinary, Hospitals Are Closed, (Rt 14)\n'); INSERT INTO `default_table` VALUES (762, 'Animal Emergency Clinic', '800 East Terra Cotta Avenue', 'Crystal Lake', 'IL', '60014', '(815) 479-9119', '', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nEmergency & Critical Care\n'); INSERT INTO `default_table` VALUES (763, 'Decatur Macon Animal Shelter Foundation', '250 North Water Street', 'Decatur', 'IL', '62523', '(217) 423-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (764, 'Decatur Animal Shelter', '2400 North Woodford Street', 'Decatur', 'IL', '62526', '(217) 425-4508', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (765, 'Homeward Bound Pet Shelter', '1720 Huston Drive', 'Decatur', 'IL', '62526', '(217) 876-1266', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (766, 'Tri County Animal Protection League', '613 River Lane', 'Dixon', 'IL', '61021', '(815) 288-7387', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nServing Lee Ogle and Whiteside Counties, Dog & Cat Adoptions, Grooming Boarding\n'); INSERT INTO `default_table` VALUES (767, 'Bess Beginnings Inc', '15518 Minerva Avenue', 'Dolton', 'IL', '60419', '(708) 201-9317', '', '', '', '', ''); INSERT INTO `default_table` VALUES (768, 'Mullen Elizabeth', '16901 Eicks Road', 'Durand', 'IL', '61024', '(815) 248-3007', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (769, 'Oxford House Pershing', '520 N 45th Street', 'East Saint Louis', 'IL', '62205', '(618) 875-3810', '', '', '', '', ''); INSERT INTO `default_table` VALUES (770, 'Bennett Philip Insurance', '645 Tollgate Road', 'Elgin', 'IL', '60123', '(847) 741-1000', 'http://www.lundstrominsurance.com', '', '', '', '\nAdditional Information:
\nFor Your Business Insurance Employee Benefits And Car/Home/Life Insurance Needs, Serving You Your Business And Your Community Since 1956\n'); INSERT INTO `default_table` VALUES (771, 'Brandt James Insurance', '645 Tollgate Road', 'Elgin', 'IL', '60123', '(847) 741-1000', 'http://www.lundstrominsurance.com', '', '', '', '\nAdditional Information:
\nFor Your Business Insurance Employee Benefits And Car/Home/Life Insurance Needs, Serving You Your Business And Your Community Since 1956\n'); INSERT INTO `default_table` VALUES (772, 'Browne Ross Insurance', '645 Tollgate Road', 'Elgin', 'IL', '60123', '(847) 741-1000', 'http://www.lundstrominsurance.com', '', '', '', '\nAdditional Information:
\nFor Your Business Insurance Employee Benefits And Car/Home/Life Insurance Needs, Serving You Your Business And Your Community Since 1956\n'); INSERT INTO `default_table` VALUES (773, 'Izral Kathy', '645 Tollgate Road', 'Elgin', 'IL', '60123', '(847) 741-1000', '', '', '', '', '\nAdditional Information:
\nFor Your Business Insurance Employee Benefits And Car/Home/Life Insurance Needs, Serving You Your Business And Your Community Since 1956\n'); INSERT INTO `default_table` VALUES (774, 'Pavlik Ronald S Insurance', '645 Tollgate Road', 'Elgin', 'IL', '60123', '(847) 741-1000', 'http://www.lundstrominsurance.com', '', '', '', '\nAdditional Information:
\nFor Your Business Insurance Employee Benefits And Car/Home/Life Insurance Needs, Serving You Your Business And Your Community Since 1956\n'); INSERT INTO `default_table` VALUES (775, 'Webb Debbie', '645 Tollgate Road', 'Elgin', 'IL', '60123', '(847) 741-1000', '', '', '', '', '\nAdditional Information:
\nFor Your Business Insurance Employee Benefits And Car/Home/Life Insurance Needs, Serving You Your Business And Your Community Since 1956\n'); INSERT INTO `default_table` VALUES (776, 'Wilder Doug', '645 Tollgate Road', 'Elgin', 'IL', '60123', '(847) 741-1000', '', '', '', '', '\nAdditional Information:
\nFor Your Business Insurance Employee Benefits And Car/Home/Life Insurance Needs, Serving You Your Business And Your Community Since 1956\n'); INSERT INTO `default_table` VALUES (777, 'Walter Daniel', '645 Tollgate Road', 'Elgin', 'IL', '60123', '(847) 741-1000', '', '', '', '', '\nAdditional Information:
\nFor Your Business Insurance Employee Benefits And Car/Home/Life Insurance Needs, Serving You Your Business And Your Community Since 1956\n'); INSERT INTO `default_table` VALUES (778, 'Lenart Roger J - Ofc', '645 Tollgate Road', 'Elgin', 'IL', '60123', '(847) 741-1000', '', '', '', '', '\nAdditional Information:
\nFor Your Business Insurance Employee Benefits And Car/Home/Life Insurance Needs, Serving You Your Business And Your Community Since 1956\n'); INSERT INTO `default_table` VALUES (779, 'Whipple Stephen T Insurance', '645 Tollgate Road', 'Elgin', 'IL', '60123', '(847) 741-1000', 'http://www.lundstrominsurance.com', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nFor Your Business Insurance Employee Benefits And Car/Home/Life Insurance Needs, Serving You Your Business And Your Community Since 1956\n'); INSERT INTO `default_table` VALUES (780, 'Stone John R Insurance', '645 Tollgate Road', 'Elgin', 'IL', '60123', '(847) 741-1000', 'http://www.lundstrominsurance.com', '', '', '', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nFor Your Business Insurance Employee Benefits And Car/Home/Life Insurance Needs, Serving You Your Business And Your Community Since 1956\n'); INSERT INTO `default_table` VALUES (781, 'Lundstrom Insurance', '645 Tollgate Road', 'Elgin', 'IL', '60123', '(847) 741-1000', 'http://www.lundstrominsurance.com', '', '', '24 Hours/7 Days', '\nBrands:
\n\n
Specialties:
\n\n
Additional Information:
\nAuto, Motorcycle, RV, Boat, ATV, Commercial Auto, Snowmobile, Local Authorized Agents\n'); INSERT INTO `default_table` VALUES (782, 'Jo Daviess County - Animal Control', '791 US Highway 20 West', 'Elizabeth', 'IL', '61028', '(815) 858-2405', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (783, 'Evanston Animal Shelter', '2310 Oakton Street', 'Evanston', 'IL', '60202', '(847) 866-5080', 'http://www.care-evanston.org', 'info@anticruelty.org', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nQuality Cats & Dogs For Adoption, Volunteers Welcome\n'); INSERT INTO `default_table` VALUES (784, 'Quarter C Pet Resort', '5452 East 1750 North Road', 'Fithian', 'IL', '61844', '(217) 548-2014', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (785, 'Friends Forever Humane Society', '966 West Rudy Road', 'Freeport', 'IL', '61032', '(815) 232-6164', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (786, 'Stephenson County - Animal Control Department', '15 North Galena Avenue Suite 7', 'Freeport', 'IL', '61032', '(815) 235-8276', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (787, 'Knox County Humane Society', '1855 Windish Drive', 'Galesburg', 'IL', '61401', '(309) 342-1275', 'http://www.kchs.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (788, 'Prairieland Animal Welfare Center', '1855 Windish Drive', 'Galesburg', 'IL', '61401', '(309) 342-1275', '', '', '', '', ''); INSERT INTO `default_table` VALUES (789, 'Humane Society', '14606 Roos Hill Road', 'Geneseo', 'IL', '61254', '(309) 944-4868', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (790, 'Geneseo City - Animal Control Center', '14606 Roos Hill Road', 'Geneseo', 'IL', '61254', '(309) 944-4235', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (791, 'DeKalb County Animal Welfare Shelter', '16173 Baseline Road', 'Genoa', 'IL', '60135', '(815) 784-5924', 'http://www.dekalbcountyanimalshelter.org', '', '', 'Monday-Friday 8:30Am-12:30Pm-1:30Pm-4:30Pm,saturday-Sunday 8:30Am Noon', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (792, 'Pet Projects Animal Shelter Inc', '2190 State Route 23', 'Grand Ridge', 'IL', '61325', '(815) 249-5221', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (793, 'Save-A-Pet Inc', '31664 North Fairfield Road', 'Grayslake', 'IL', '60030', '(847) 740-7788', 'http://www.save-a-pet-il.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nKittens Puppies Cats & Dogs For Adoption At Our No-Kill Shelter, Don''t Keep Your Best Friend Waiting Adopt A Shelter Pet, All Animals Are Up To Date On Shots/Vaccinations, All Animals Are Spayed Or... (Show More)\nKittens Puppies Cats & Dogs For Adoption At Our No-Kill Shelter, Don''t Keep Your Best Friend Waiting Adopt A Shelter Pet, All Animals Are Up To Date On Shots/Vaccinations, All Animals Are Spayed Or Neutered, All Animals Have Microchips, Please Put Us Out Of Business Spay Or Neuter Your Pets, Please Contact Us For A Low C  (Show Less)\n'); INSERT INTO `default_table` VALUES (794, 'Saline County Animal Control', '1620 South Feazel Street', 'Harrisburg', 'IL', '62946', '(618) 252-7859', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (795, 'Highland Animal Shelter', '510 West Monroe Street', 'Highland', 'IL', '62249', '(618) 654-6067', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (796, 'Rover''s Place', '1238 Old Skokie Road', 'Highland Park', 'IL', '60035', '(847) 831-3783', 'http://www.roversplacechicago.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDoggie Daycare, Do-It-Yourself Wash, Where Your Dog Is Treated Like Royalty, Supervised Indoor And Outdoor Play Area, Overnight Staff, Option To Bring Your Dog''s Own Bedding And Toys, We Administer... (Show More)\nDoggie Daycare, Do-It-Yourself Wash, Where Your Dog Is Treated Like Royalty, Supervised Indoor And Outdoor Play Area, Overnight Staff, Option To Bring Your Dog''s Own Bedding And Toys, We Administer Medication And Honor Special Diets, Free Bath With A Three Night Stay, Holidays Require 5 Nights  (Show Less)\n'); INSERT INTO `default_table` VALUES (797, 'Hinsdale Humane Society', '22 North Elm Street', 'Hinsdale', 'IL', '60521', '(630) 323-5630', 'http://www.hinsdalehumanesociety.org', 'info@towershow.com', '', 'Closed Mondays', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLooking For A Pet To Adopt, Need To Give Up A Pet, See Us For All Your Animal Needs, Pet Supplies And Advice Also Available\n'); INSERT INTO `default_table` VALUES (798, 'Animal House Shelter', '13005 Ernesti Road', 'Huntley', 'IL', '60142', '(847) 961-5541', 'http://www.animalhouseshelter.com', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nRescue Your Next Puppy Kitten Dog Or Cat, All Dogs & Cats, Are Microchipped, Please Visit Our Website For Directions Of wwwAnimalhouseSheltercom\n'); INSERT INTO `default_table` VALUES (799, 'Animal House Shelter', '13005 Ernesh Road', 'Huntley', 'IL', '60142', '(847) 961-5125', '', '', '', '', ''); INSERT INTO `default_table` VALUES (800, 'Will County Humane Society', '24109 West Seil Road', 'Joliet', 'IL', '60404', '(815) 741-0695', 'http://www.wchumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (801, 'Animal Control Center', '2807 McDonough Street', 'Joliet', 'IL', '60436', '(815) 725-0333', 'http://www.joliettownship.net', '', '', 'Monday-Friday 8:30 A.m. To Noon', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (802, 'The A R K', '479 State Route 26', 'Lacon', 'IL', '61540', '(309) 246-4275', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (803, 'Cat Nap From The Heart', '1101 Beach Avenue', 'La Grange Park', 'IL', '60526', '(708) 352-3914', 'http://www.catnapfromtheheart.org', 'catnapqueen@yahoo.com', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n'); INSERT INTO `default_table` VALUES (804, 'Animal Education & Rescue', '523 West Park Avenue', 'Libertyville', 'IL', '60048', '(847) 816-0831', 'http://www.animaleducationandrescue.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (805, 'T L C Animal Shelter', '13016 West 151st Street', 'Lockport', 'IL', '60491', '(708) 301-1594', 'http://www.tlcanimalshelter.org', '', '', '11 Am-4 Pm Tuesday Through Saturday', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (806, 'Cat Guardians', '932 East Saint Charles Road', 'Lombard', 'IL', '60148', '(630) 543-3395', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (807, 'Raquanss Heaven Inc', '1117 South E Cambria Lane', 'Lombard', 'IL', '60148', '(630) 424-1020', '', '', '', '', ''); INSERT INTO `default_table` VALUES (808, 'Clay County Animal Protection', '14400 Highway 45', 'Louisville', 'IL', '62858', '(618) 665-3005', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (809, 'Just Animals Shelter', '2996 North 26th Road', 'Marseilles', 'IL', '61341', '(815) 357-1223', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (810, 'Animal Outreach Society', '1203 May Avenue', 'Mchenry', 'IL', '60050', '(815) 385-0005', 'http://www.animaloutreachsociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (811, 'Regap Of Illinois', '4107 E 3rd Road', 'Mendota', 'IL', '61342', '(815) 538-3647', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nRetired Greyhound Adoptions\n'); INSERT INTO `default_table` VALUES (812, 'Project Hope Humane Society', '1660 West 10th Street', 'Metropolis', 'IL', '62960', '(618) 524-8939', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (813, 'All Animals Humane Society Inc', '5111 78th Avenue', 'Milan', 'IL', '61264', '(309) 799-5554', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (814, 'Carroll County - Court House, Animal Control', '10735 Mill Road', 'Mount Carroll', 'IL', '61053', '(815) 244-9705', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (815, 'Jefferson County Animal Shelter', '107 East Perkins Avenue', 'Mount Vernon', 'IL', '62864', '(618) 244-8024', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (816, 'Naperville Area Humane Society Inc', '1620 West Diehl Road', 'Naperville', 'IL', '60563', '(630) 420-8989', 'http://www.napervillehumanesociety.org', 'info@napervillehumanesociety.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (817, 'Adopt Animals Deserving of Proper Treatment', '420 Industrial Drive', 'Naperville', 'IL', '60563', '(630) 355-2299', 'http://www.adoptpetsheller.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (818, 'Humane Society of Central Illinois', '423 Kays Drive', 'Normal', 'IL', '61761', '(309) 451-1000', '', '', '', '', ''); INSERT INTO `default_table` VALUES (819, 'Heartland Animal Shelter', '2975 Milwaukee', 'Northbrook', 'IL', '60062', '(847) 296-6400', 'http://www.heartlandanimalshelter.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (820, 'Society Of Vertebrate Paleontology', '60 Revere Drive', 'Northbrook', 'IL', '60062', '(847) 480-9095', '', 'svp@vertpaleo.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (821, 'Doggie Daycare', '325 Morse Drive', 'Northlake', 'IL', '60164', '(708) 681-4122', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (822, 'Orland Park Boarding Kennel', '15701 Wolf Road', 'Orland Park', 'IL', '60467', '(708) 349-9424', 'http://www.opboardingkennel.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nBoarding - Dogs & Cats Separated, Individual Runs, Air Conditioning/Heated, Pet Food/Supplies, Current Shots Required, Over 20 Years In Business, Piped In Music, Member ABKA, State Licensed\n'); INSERT INTO `default_table` VALUES (823, 'Under His Wings Home For Women', '301 Nebraska Street', 'Ottawa', 'IL', '61350', '(815) 431-0304', '', '', '', '', ''); INSERT INTO `default_table` VALUES (824, 'Edgar County - Animal Shelter', '1023 North High Street', 'Paris', 'IL', '61944', '(217) 466-9415', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (825, 'Bryant C D DVM', '2348 Western Avenue', 'Park Forest', 'IL', '60466', '(708) 748-0022', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (826, 'Friederich Gary R Dvm', '2348 Western Avenue', 'Park Forest', 'IL', '60466', '(708) 748-0022', '', '', '', 'Monday-Friday 9:00Am-7:00Pm Saturday 9:00Am-4:00Pm 24 Hour Emergency Service', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (827, 'All Night Animal Hospital Emergency Clinic', '2348 Western Avenue', 'Park Forest', 'IL', '60466', '(708) 748-0022', '', '', '', 'Monday Friday 9:00Am 7:00Pm Saturday 9:00Am 4:00Pm', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (828, 'Matteson Veterinarian', '2348 Western Avenue', 'Park Forest', 'IL', '60466', '(708) 748-0022', '', '', '', 'Monday-Friday 9:00Am-7:00Pm Saturday 9:00Am-4:00Pm 24 Hour Emergency Service', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (829, 'Humane Society', '2675 Allentown Road', 'Pekin', 'IL', '61554', '(309) 353-8277', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (830, 'Taps Animal Shelter', '2675 Allentown Road', 'Pekin', 'IL', '61554', '(309) 353-8277', 'http://www.tapsshelter.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (831, 'The Need To Know', '1723 West Detweiller Drive', 'Peoria', 'IL', '61615', '(309) 683-0169', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (832, 'Peoria Animal Welfare Shelter', '2600 Northeast Perry Avenue', 'Peoria', 'IL', '61603', '(309) 494-8911', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (833, 'Pike County Animal Control', '909 North Jackson Street', 'Pittsfield', 'IL', '62363', '(217) 285-4811', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (834, 'Livingston County Humane Society', '21179 N 1358 East Rd', 'Pontiac', 'IL', '61764', '(815) 842-1025', 'http://www.lchumanesociety.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (835, 'Friends Of Strays Inc', '2845 North Main Street', 'Princeton', 'IL', '61356', '(815) 872-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (836, 'Frnds Strays Inc', '2845 N Main Street', 'Princeton', 'IL', '61356', '(815) 872-7387', '', '', '', '', ''); INSERT INTO `default_table` VALUES (837, 'Adopt-A-Pet Inc', '110 North Pine Street', 'Prospect Heights', 'IL', '60070', '(847) 870-8999', 'http://www.adopt-a-pet-inc.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (838, 'Quanada', '2224 Harrison Street', 'Quincy', 'IL', '62301', '(217) 641-0180', '', '', '', '', ''); INSERT INTO `default_table` VALUES (839, 'Quincy Humane Society', '3411 South 12th Street', 'Quincy', 'IL', '62305', '(217) 223-8786', 'http://www.quincyhumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (840, 'Animal Shelter Of Quincy', '3910 Wisman Lane', 'Quincy', 'IL', '62305', '(217) 222-2133', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (841, 'Pets In Need', '4509 South Ridgeway Road', 'Ringwood', 'IL', '60072', '(815) 728-1462', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (842, 'Watchful Eye Home Inspection', '4509 South Ridgeway Road', 'Ringwood', 'IL', '60072', '(815) 728-1462', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (843, 'Pets In Need', '4509 South Ridgeway Road', 'Ringwood', 'IL', '60072', '(918) 827-6552', 'http://www.petsinneedmidwest.org', '', '', 'Wednesday, Friday 10:00am-3:00pm Saturday 10:00am-4:00pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (844, 'Orphans Of The Storm Animal Shelter', '2200 Riverwoods Road', 'Riverwoods', 'IL', '60015', '(847) 945-0235', 'http://www.orphansofthestorm.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (845, 'Winnebago County Div Of Animal Services', '4517 North Main Street', 'Rockford', 'IL', '61103', '(815) 877-3073', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (846, 'Noah''s Ark Animal Sanctuary Inc', '111 North 1st Street', 'Rockford', 'IL', '61107', '(815) 962-2767', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (847, 'Canine & Kitty City', '1027 West Main Street', 'Salem', 'IL', '62881', '(618) 548-5440', '', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Additional Information:
\nProfessional Dog & Car Grooming, With 7 Years Experience\n'); INSERT INTO `default_table` VALUES (848, 'Critter Sitters', '107 North East Street', 'Smithton', 'IL', '62285', '(618) 233-7386', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (849, 'Anderson Animal Shelter-A Humane Society', '1000 South La Fox Street', 'South Elgin', 'IL', '60177', '(847) 697-2880', 'http://www.andersonanimalshelter.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDog Obedience, Low Cost Public Spay/Neuter\n'); INSERT INTO `default_table` VALUES (850, 'Ounce Of Prevention Fund', '1 West Old State Capitol Place', 'Springfield', 'IL', '62701', '(217) 522-5510', 'http://www.ounceofprevention.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (851, 'Animal Protective League', '1001 Taintor Road', 'Springfield', 'IL', '62702', '(217) 544-7387', 'http://www.springfield-illinois.com/apl', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nNo-Kill Shelter Supported Solely By Donations Not-For-Profit Adoptions Spay/Neuter Clinic, No Of State Fairgrounds\n'); INSERT INTO `default_table` VALUES (852, 'Chicago Housing Authority Springfield', '835 S 2nd Street', 'Springfield', 'IL', '62704', '(217) 544-2082', '', '', '', '', ''); INSERT INTO `default_table` VALUES (853, 'Sangamon County Department Of Public Health - Animal Control', '2100 Shale Street', 'Springfield', 'IL', '62703', '(217) 535-3065', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (854, 'Whiteside County - Health Department, County Health Dept, Animal Control Div', '2350 West Lynn Boulevard', 'Sterling', 'IL', '61081', '(815) 625-3507', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (855, 'Humane Society Happy Tails', '16761 Hickory Hills Road', 'Sterling', 'IL', '61081', '(815) 626-2994', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (856, 'Paws Animal Shelter', '8301 191st Street', 'Tinley Park', 'IL', '60487', '(815) 464-7298', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (857, 'Fayette County Animal Control', '2030 North 8th Street', 'Vandalia', 'IL', '62471', '(618) 283-1791', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (858, 'Silver Pines', '24777 North Highway 21', 'Vernon Hills', 'IL', '60061', '(847) 634-0722', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (859, 'Dupage Animal Control', '421 North County Farm Road', 'Wheaton', 'IL', '60187', '(630) 682-7197', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (860, 'Kendall County - Animal Warden', '1204 John Street', 'Yorkville', 'IL', '60560', '(630) 553-9256', 'http://www.co.kendall.il.us', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (861, 'Tippecanoe County Humane Society', '1705 S 2nd', 'Lafayette', 'IN', '47905', '(765) 474-5222', 'http://www.tipphumane.org', 'tipphmane@earthlink.net', '', 'Tuesday Through Friday-Noon To 7 P.m. Saturday-10 A.m. To 4 P.m.', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nPuppies & Dogs, all kinds, Kittens & Cats, many varieties, Small Cage Animals, rabbits, guinea pigs, hamsters\n'); INSERT INTO `default_table` VALUES (862, 'Animal Shelter-Anderson', '613 Dewey Street', 'Anderson', 'IN', '46016', '(765) 648-6305', 'http://www.andersonanimalshelter.com', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nOffices May Be Dialed Direct For Faster Service If You Don''t Find The Number Call\n'); INSERT INTO `default_table` VALUES (863, 'Fountain County Animal Shelter', '2421 North Foster Road', 'Attica', 'IN', '47918', '(765) 295-0270', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (864, 'White River Humane Society', '3511 Pumphouse Road', 'Bedford', 'IN', '47421', '(812) 279-2457', 'http://www.whiteriverhumanesociety.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (865, 'Animal Shelter', '3410 South Old State Road 37', 'Bloomington', 'IN', '47401', '(812) 349-3492', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (866, 'Pets Alive', '101 West Kirkwood Avenue', 'Bloomington', 'IN', '47404', '(812) 824-1349', 'http://www.petsalivespayneuter.org', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (867, 'Elkhart County Humane Society', '54687 County Road 19', 'Bristol', 'IN', '46507', '(574) 848-4225', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (868, 'Animal Shelter of Perry County', '6279 Sycamore Road', 'Cannelton', 'IN', '47520', '(812) 547-6381', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (869, 'Exotic Feline Rescue Center', '2221 East Ashboro Road', 'Centerpoint', 'IN', '47840', '(812) 835-1130', 'http://www.exoticfelinerescuecenter.org', 'efrc@claynet.com', '', '', '\nAdditional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (870, 'Humane Society Of Whitley County', '951 E South Ave', 'Columbia City', 'IN', '46725', '(260) 244-6664', 'http://www.hswc.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (871, 'Columbus City - Animal Shelter', '2730 Arnold Street', 'Columbus', 'IN', '47203', '(812) 376-2505', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (872, 'Fayette County - Animal Shelter', '1703 Michigan Avenue', 'Connersville', 'IN', '47331', '(765) 825-8693', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (873, 'Animal Welfare League Of Montgomery County', '1104 Big Four Arch Road', 'Crawfordsvlle', 'IN', '47933', '(765) 362-8846', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (874, 'Lake County Animal Control', '3011 West 93rd Avenue', 'Crown Point', 'IN', '46307', '(219) 769-7016', 'http://www.lakecountyin.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (875, 'Wildcat Wildlife Center Inc', '4709 North 400 West', 'Delphi', 'IN', '46923', '(574) 686-3069', '', '', '', '', '\nAdditional Information:
\nWildlife Services\n'); INSERT INTO `default_table` VALUES (876, 'Miami County Dog Pound', '8053 West North 300', 'Denver', 'IN', '46926', '(765) 985-2070', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (877, 'Stillwater Kennel', '15205 Old Princeton Road', 'Evansville', 'IN', '47725', '(812) 867-3694', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (878, 'Vanderburgh Humane Society', '400 Millner Industrial D', 'Evansville', 'IN', '47710', '(812) 426-2563', 'http://www.vhslifesaver.org', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (879, 'Animal Shelter', '1101 Buchanan', 'Evansville', 'IN', '47720', '(812) 426-2563', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPet Shops, Animal Shelters\n'); INSERT INTO `default_table` VALUES (880, 'Hendrickson Dale Dvm', '1452 South 1000 West', 'Farmland', 'IN', '47340', '(765) 468-6099', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (881, 'Stoney Creek Farms', '1452 South 1000 West', 'Farmland', 'IN', '47340', '(765) 468-6099', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (882, 'Fishers Veterinary Associates', '11681 Brooks School Road Suite 7', 'Fishers', 'IN', '46037', '(317) 585-4730', 'http://www.fishers.com', '', '', 'Drop Off Service By Appointment,evening Appointments Available,24 Hour Emergency Service', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (883, 'Society For The Prevention Of Cruelty To Animals', '4914 Hanna', 'Fort Wayne', 'IN', '46806', '(260) 744-0454', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (884, 'Spca Pet Shelter & Adoption Center', '4914 Hanna Street', 'Fort Wayne', 'IN', '46806', '(260) 744-0454', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (885, 'Fort Wayne City - Animal Care & Control', '3020 Hillegas Road', 'Fort Wayne', 'IN', '46808', '(260) 427-1244', 'http://www.cityoffortwayne.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (886, 'Fried''s Cat Shelter', '11111 x st', 'Fort Wayne', 'IN', '46804', '(219) 874-6932', '', '', '', 'Mon-Fri: 10:00am-04:00pm
Sat-Sun: 12:00pm-04:00pm', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (887, 'Humane Society of Clinton County', '825 Izak Walton Drive', 'Frankfort', 'IN', '46041', '(765) 654-7717', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (888, 'Johnson County - Offices & Departments, Animal Shelter', '1061 Hospital Road', 'Franklin', 'IN', '46131', '(317) 736-3924', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (889, 'New Hope Therapeutic Equestrian Center Inc', '6125 North 400 East', 'Greenfield', 'IN', '46140', '(317) 326-4163', 'http://newhopetec.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAll Services By In Kind Donation, We Are A Non Profit 501 c 3 Therapeutic Riding Organization Promoting Work With Rescued Horses And Other Animals In The Treatment Of People With Emotional... (Show More)\nAll Services By In Kind Donation, We Are A Non Profit 501 c 3 Therapeutic Riding Organization Promoting Work With Rescued Horses And Other Animals In The Treatment Of People With Emotional Behavioral Social Mental Physical And/Or Spiritual Needs, Therapeutic Riding Lessons & Horse Care, Horse & Dog Gentling & Training, Animal Rescue Relocation & Transporting, Club Service Hours For Volunteers, Elective Credit Hour Program, College Internships, Horse Back Riding - Day Rides & Field Trips, Horseman''s Camping Trips Up To 3 Weeks, Do You Know Someone Who Needs A Positive Constructive Self Esteem Building Way To Spend Their Time, Your Place Or Ours, Please Call To Schedule Consultation, Times & Location Varies Depending On Services Requested, Try Volunteering At New Hope TEC Inc, Training Is Required  (Show Less)\n'); INSERT INTO `default_table` VALUES (890, 'Humane Society of Hancock County', '214 East Main Street', 'Greenfield', 'IN', '46140', '(317) 462-5404', 'http://www.hancockhumanesociety.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (891, 'Helping Paws Cat Adoption Center', '7005 Old US Highway 24', 'Huntington', 'IN', '46750', '(260) 356-5330', '', '', '', '', ''); INSERT INTO `default_table` VALUES (892, 'Southside Animal Shelter', '108 North Maple Drive', 'Indianapolis', 'IN', '46201', '(317) 882-4080', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (893, 'Horizon House Inc', '960 E Washington Street', 'Indianapolis', 'IN', '46202', '(317) 951-4075', '', '', '', '', ''); INSERT INTO `default_table` VALUES (894, 'Wailing Women Win Inc', '9426 Pepperidge Drive', 'Indianapolis', 'IN', '46235', '(317) 687-6795', '', '', '', '', ''); INSERT INTO `default_table` VALUES (895, 'Animal Protection ASSC Inc', '425 Meigs Avenue', 'Jeffersonville', 'IN', '47130', '(812) 283-6555', 'http://www.apa-pets.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (896, 'Animal Protection', '702 East 11th Street', 'Jeffersonville', 'IN', '47130', '(812) 218-8857', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (897, 'Wild Side Nuisance Animal Control', '6142 East Leighty Road', 'Kendallville', 'IN', '46755', '(260) 347-5664', '', '', '', '', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nProfessional Removal Of, Moles, Coyotes, Muskrats, Beaver, Rats, Serving All Of Noble County And Parts Of Surrounding Counties\n'); INSERT INTO `default_table` VALUES (898, 'Country Clipper', '6142 East Leighty Road', 'Kendallville', 'IN', '46755', '(260) 347-5664', '', '', '', 'Hours by Appointment', '\nSpecialties:
\n\n
Additional Information:
\nDeb Sibert, All Breeds, Dog & Cat Grooming, Drop Off & Pick Up To Fit Your Schedule, Call For Appointment\n'); INSERT INTO `default_table` VALUES (899, 'Humane Society of Noble County', '1305 Sherman Street', 'Kendallville', 'IN', '46755', '(260) 347-2563', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (900, 'Animal Shelter', '1705 South 2nd Street', 'Lafayette', 'IN', '47905', '(765) 474-5222', 'http://www.tipphumane.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPuppies & Dogs, all kinds, Kittens & Cats, many varieties, Small Cage Animals, rabbits, guinea pigs, hamsters\n'); INSERT INTO `default_table` VALUES (901, 'Tippecanoe County Humane Society', '1705 S 2nd', 'Lafayette', 'IN', '47905', '(765) 474-5222', 'http://www.tipphumane.org', 'tipphmane@earthlink.net', '', 'Tuesday Through Friday-Noon To 7 P.m. Saturday-10 A.m. To 4 P.m.', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nPuppies & Dogs, all kinds, Kittens & Cats, many varieties, Small Cage Animals, rabbits, guinea pigs, hamsters\n'); INSERT INTO `default_table` VALUES (902, 'Petsavers No Kill Shelter', '8 South 16th Street', 'Lafayette', 'IN', '47905', '(765) 742-2200', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nGrooming & Boarding, Pet Savers\n'); INSERT INTO `default_table` VALUES (903, 'Laporte County - Small Animal Shelter', '2855 West State Road 2', 'La Porte', 'IN', '46350', '(219) 326-1637', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (904, 'P C Animal Shelter', '1013 Indiana Avenue', 'La Porte', 'IN', '46350', '(219) 326-7319', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (905, 'Cass County Animal Shelter', '1251 North State Road 17', 'Logansport', 'IN', '46947', '(574) 739-1179', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (906, 'Animal Shelter', '2727 Hannah Drive', 'Madison', 'IN', '47250', '(812) 273-1788', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (907, 'Grant County Humane Society Shelter', '2768 West Avon Avenue', 'Marion', 'IN', '46953', '(765) 664-1111', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (908, 'Morgan County Humane Society', '690 West Mitchell Avenue', 'Martinsville', 'IN', '46151', '(765) 349-9177', 'http://www.mchumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (909, 'Lake County Government Offices - Crown Point Gary, Animal Control', '3011 West 93rd Avenue', 'Merrillville', 'IN', '46410', '(219) 769-7016', 'http://www.lakecountyin.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (910, 'Fried Hans', '509 Indiana Highway 212', 'Michigan City', 'IN', '46360', '(219) 874-6932', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (911, 'Fried''s Cat Shelter Inc', '509 Indiana Highway 212', 'Michigan City', 'IN', '46360', '(219) 874-6932', 'http://www.fredscatshelter.org', 'freds@adsnet.com', '', 'Thu-Fri: 10:00am-04:00pm
Sat-Sun: 12:00pm-04:00pm', '\nProducts & Services:
\n\n
Additional Information:
\nDonations Accepted, All Cats Must Be Spade/Nuetered.Adoptions Welcome\n'); INSERT INTO `default_table` VALUES (912, 'Pet Refuge Inc', '2300 West 6th Street', 'Mishawaka', 'IN', '46544', '(574) 256-0886', 'http://www.petrefuge.com', '', '', '', '\nAdditional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (913, 'Adams County Animal Shelter', '2168 South 300 East', 'Monroe', 'IN', '46772', '(260) 692-6819', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (914, 'Muncie City - Animal Shelter', '2401 South Gharkey Street', 'Muncie', 'IN', '47302', '(765) 747-4851', 'http://www.animalshelter.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (915, 'S Pca', '1215 East 14th Street', 'Muncie', 'IN', '47302', '(765) 284-5606', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (916, 'Society for the Prevention of Cruelty To Animals of Delaware COU', '1215 East 14th Street', 'Muncie', 'IN', '47302', '(765) 284-5606', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (917, 'Animal Rescue Fund', '1209 West Riggin Road', 'Muncie', 'IN', '47303', '(765) 282-2733', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (918, 'Arfs Kitty Korner', '1600 West Riggin', 'Muncie', 'IN', '47303', '(765) 282-9770', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (919, 'Pet Adoption Center', '5722 Vann Road', 'Newburgh', 'IN', '47630', '(812) 858-1132', 'http://www.petadoptioncenter.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (920, 'Home Away Pet Lodge', '5722 Vann Road', 'Newburgh', 'IN', '47630', '(812) 490-7011', '', '', '', '', ''); INSERT INTO `default_table` VALUES (921, 'Animal Shelter', '37 West 5th Street', 'New Albany', 'IN', '47150', '(812) 948-5355', '', '', '', 'Tuesday-Friday Noon-4:00Pm,saturday 10:30Am-4:00Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (922, 'Henry County Humane Society Animal Shelter', '11 Midway Drive', 'New Castle', 'IN', '47362', '(765) 529-8131', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (923, 'Bethany Tabernacle Christian Love Shelter House', '418 S 18th Street', 'New Castle', 'IN', '47362', '(765) 521-2837', '', '', '', '', ''); INSERT INTO `default_table` VALUES (924, 'Humane Society for Hamilton County', '18102 Cumberland Road', 'Noblesville', 'IN', '46060', '(317) 773-4974', 'http://www.hamiltonhumane.com', '', '', 'Monday-Saturday 12-5 Pm, Sunday 12-3 Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (925, 'Starke County Humane Society', '0104 West State Road 10', 'North Judson', 'IN', '46366', '(574) 896-5060', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (926, 'Jennings County Animal Control', '580 West County Road 350 North', 'North Vernon', 'IN', '47265', '(812) 346-5725', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (927, 'Pike Animal Welfare Shelter', '4224 North Meridian Road', 'Petersburg', 'IN', '47567', '(812) 354-9894', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (928, 'Kosciusko County Animal Shelter', '3489 East 100 South', 'Pierceton', 'IN', '46562', '(574) 267-3008', 'http://www.awl-warsaw.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (929, 'Marshall County - Humane Society', '11165 13th Road', 'Plymouth', 'IN', '46563', '(574) 936-8300', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (930, 'Help the Animals Inc', '2101 West Main Street', 'Richmond', 'IN', '47374', '(765) 962-6811', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (931, 'Animal Welfare Shelter', '1825 Chester Boulevard', 'Richmond', 'IN', '47374', '(765) 962-8393', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (932, 'Schererville Animal Control', '540 Kaeser Boulevard', 'Schererville', 'IN', '46375', '(219) 865-6992', '', '', '', '', ''); INSERT INTO `default_table` VALUES (933, 'Animal Shelter', '705 Hale Road', 'Shelbyville', 'IN', '46176', '(317) 392-5127', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (934, 'Owen County Humane Society', '2014 West Romona Road', 'Spencer', 'IN', '47460', '(812) 829-6247', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (935, 'Animal Shelter of Wabash CO', '810 Manchester Avenue', 'Wabash', 'IN', '46992', '(260) 563-3511', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (936, 'Riverside Veterinary Clinic', '106 South Wayne', 'Warren', 'IN', '46792', '(260) 375-2255', '', '', '', 'Mon-Fri/Weekdays', '\nProducts & Services:
\n\n
Additional Information:
\nSmall Animal Medicine And Surgery, Convenient Drop-Off Service Available, Hills Science Diet Pet Food, Flea And Tick Products\n'); INSERT INTO `default_table` VALUES (937, 'Kosciusko County - Animal Shelter', '3489 West 100 South', 'Warsaw', 'IN', '46580', '(574) 267-3008', 'http://www.awl-warsaw.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (938, 'Washington City - Animal Control Shelter & Adoption', '415 Clark Road', 'Washington', 'IN', '47501', '(812) 254-8226', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (939, 'Home for Friendless Animals', '7649 West 200 South', 'Waynetown', 'IN', '47990', '(765) 866-1760', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (940, 'Independent Cat Society', '4061 South County Line Road', 'Westville', 'IN', '46391', '(219) 785-4936', 'http://www.catsociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (941, 'Randolph County Animal Shelter', '1040 North 200 West', 'Winchester', 'IN', '47394', '(765) 468-6099', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (942, 'Harmony Haven Inc', '1049 West Sandford Avenue', 'W Terre Haute', 'IN', '47885', '(812) 535-3819', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (943, 'Ames Animal Shelter & Control', '325 Billy Sunday Road', 'Ames', 'IA', '50010', '(515) 239-5530', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (944, 'Atlantic City - Animal Shelter', '309 Sunnyside Lane', 'Atlantic', 'IA', '50022', '(712) 243-2287', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (945, 'Boone Area Humane Society', '228 West 16th Street', 'Boone', 'IA', '50036', '(515) 432-6112', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (946, 'Humane Society of Floyd CTY', '303 Shaw Avenue', 'Charles City', 'IA', '50616', '(641) 257-0766', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (947, 'Animal Shelter', '2821 South 15th Street', 'Council Bluffs', 'IA', '51501', '(712) 328-4656', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (948, 'Animal Rescue League Of Iowa Inc', '1615 Southeast 14th Street', 'Des Moines', 'IA', '50320', '(515) 284-6905', 'http://www.arl-iowa.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (949, 'Dubuque Humane Society', '175 North Crescent Rdg', 'Dubuque', 'IA', '52003', '(563) 582-6766', 'http://www.dbqhumane.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nTraining Classes, Day Care/Pet Sitting, Pet Cemetery\n'); INSERT INTO `default_table` VALUES (950, 'Animal Control', '1401 Cedar Bend Lane', 'Ely', 'IA', '52227', '(319) 848-7373', 'http://www.cedar-rapids.org', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (951, 'Noah''s Ark Foundation', '1986 West Gear Avenue', 'Fairfield', 'IA', '52556', '(641) 472-6080', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (952, 'Paw Animal Shelter', '2031 48th Street', 'Fort Madison', 'IA', '52627', '(319) 372-2274', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (953, 'Coldwater Kennel', '12059 Camp Comfort Road', 'Greene', 'IA', '50636', '(641) 823-5862', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (954, 'Preferred Pest Control', '5415 Northwest 88th Street Suite 200', 'Johnston', 'IA', '50131', '(515) 276-7277', 'http://www.preferredpest.com', '', '', '', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nTermite Specialists, When You''re Really Had Enough, Call The Only Local Business Owned By An ISU Graduate Entomologist, Same Days Service For Mosquito''s, Party And Event Fogging, Automatic Misting... (Show More)\nTermite Specialists, When You''re Really Had Enough, Call The Only Local Business Owned By An ISU Graduate Entomologist, Same Days Service For Mosquito''s, Party And Event Fogging, Automatic Misting Systems, Yard And Acreage Treatments, No Contracts Required, Free Insect Identification, Professional E  (Show Less)\n'); INSERT INTO `default_table` VALUES (955, 'Critter Control Of Iowa', '5331 James Avenue Southwest', 'Kalona', 'IA', '52247', '(319) 683-2560', 'http://www.crittercontrol.com', '', '', '24 Hour Service', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nProtecting People Property & Wildlife, Moles, Birds Etc, Animal Entry Inspections & Repairs, Humane Removal & Exclusion, Attic & Chimney Screens Installed\n'); INSERT INTO `default_table` VALUES (956, 'Keokuk Humane Society', '1129 Johnson Street', 'Keokuk', 'IA', '52632', '(319) 524-3816', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (957, 'City Of Keokuk Animal Shelter', '249 Carbide Lane', 'Keokuk', 'IA', '52632', '(319) 524-2669', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (958, 'Animal Rescue League', '1921 Taylor Avenue', 'Marshalltown', 'IA', '50158', '(641) 753-9046', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (959, 'Iowa State - Department of Natural Resoures, Wildlife Biologist', '2608 South 2nd Street', 'Marshalltown', 'IA', '50158', '(641) 752-5521', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (960, 'Humane Society Of North Iowa', '1520 North Federal Avenue', 'Mason City', 'IA', '50401', '(641) 423-6241', 'http://www.hsni.org', 'hsni@netconx.net', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (961, 'Animal Shelter', '631 7th Place Southeast', 'Mason City', 'IA', '50401', '(641) 424-6508', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (962, 'Story County Animal Shelter', '906 West 18th Street', 'Nevada', 'IA', '50201', '(515) 382-3338', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (963, 'Stephen Memorial Animal Shelter', '2299 235th Street', 'Oskaloosa', 'IA', '52577', '(641) 673-3991', 'http://www.smas.petfinder.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (964, 'Heartland Humane Society', '314 Fox Sauk Road', 'Ottumwa', 'IA', '52501', '(641) 682-1228', 'http://www.heartlandhumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (965, 'Cedar Bend Humane Society', '1166 West Airline Highway', 'Waterloo', 'IA', '50703', '(319) 232-6887', 'http://www.cedarbendhumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (966, 'Arl West', '1500 22nd Street', 'West Des Moines', 'IA', '50266', '(515) 440-0979', 'http://www.arl-iowa.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nSave A Life - Adopt A Pet, Mixed & Pure Breeds, Spayed, Neutered, Microchipped\n'); INSERT INTO `default_table` VALUES (967, 'Animal Rescue League West Adoptions Only', '1420 22nd Street', 'West Des Moines', 'IA', '50266', '(515) 440-0979', 'http://www.arl-iowa.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (968, 'Animal Shelter', '104 North 14th Avenue', 'Dodge City', 'KS', '67801', '(620) 225-1567', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (969, 'Dodge City Animal Shelter', '104 North 14th Avenue', 'Dodge City', 'KS', '67801', '(620) 225-8180', 'http://www.dodgecity.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (970, 'Humane Society of High Plains', '2050 East US Highway 40', 'Hays', 'KS', '67601', '(785) 625-5252', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (971, 'Awol Humane Society', '325 South 23rd Street', 'Independence', 'KS', '67301', '(620) 331-7931', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (972, 'Animal Control Center', '2324 North Jackson Street', 'Junction City', 'KS', '66441', '(785) 238-1359', '', '', '', 'Monday-Friday 4:00Pm-7:00Pm,saturday-Sunday 1:00Pm-4:00Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (973, 'Animal Control-Shelter of Kansas City KS', '3301 Park Drive', 'Kansas City', 'KS', '66102', '(913) 321-1445', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (974, 'Wyandotte-County Kansas City Kansas-Unified Govt - Emergency Medical Services Emergency Medical', '3301 Park Drive', 'Kansas City', 'KS', '66102', '(913) 321-1445', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (975, 'Wyandotte County Government - Animal Control', '3301 Park Drive', 'Kansas City', 'KS', '66102', '(913) 321-1445', 'http://wyandottecountyks.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (976, 'Animals - Animal Haven', '9800 West 67', 'Kansas City', 'KS', '66102', '(913) 432-7548', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (977, 'Animal Shelter-Lawrence Humane Society', '1805 East 19th Street', 'Lawrence', 'KS', '66046', '(785) 843-6835', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (978, 'Liberal City - Animal Shelter', '1985 North Country Estates Road', 'Liberal', 'KS', '67901', '(620) 626-0576', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (979, 'Manhattan City - Parks & Recreation Department, Animal Shelter', '605 Levee Drive', 'Manhattan', 'KS', '66502', '(785) 587-2783', '', '', '', 'Monday-Sunday 1:00Pm-5:30Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (980, 'Manhattan City - Parks & Recreation Department, Animal Control-Ext 1', '605 Levee Drive', 'Manhattan', 'KS', '66502', '(785) 537-2112', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (981, 'T Russell Reitz Regional Animal Shelter', '605 Levee Drive', 'Manhattan', 'KS', '66502', '(785) 537-2112', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (982, 'T Russell Reitz Regional Animal Shelter', '605 Levee Drive', 'Manhattan', 'KS', '66502', '(785) 587-2783', '', '', '', 'Monday-Sunday 1:00Pm-5:30Pm', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (983, 'Norton Animal Control', '302 East Washington Street', 'Norton', 'KS', '67654', '(785) 874-4294', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (984, 'Bea Martin Peck Animal Shelter', '230 West 19th Street', 'Ottawa', 'KS', '66067', '(785) 242-2967', 'http://www.bmpas.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (985, 'Beak N Wings Inc', '6600 Metcalf Avenue', 'Overland Park', 'KS', '66202', '(913) 722-2632', '', '', '', '', ''); INSERT INTO `default_table` VALUES (986, 'Animal Shelter', '329 North 2nd Street', 'Salina', 'KS', '67401', '(785) 826-6535', '', '', '', 'M-F 9-1-3-5:30,sat 10-12', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (987, 'Chautauqua County Animal Shelter', '421 South Montgomery Street', 'Sedan', 'KS', '67361', '(620) 725-3561', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (988, 'Animal Haven Animal Shelter', '9800 West 67th Street', 'Shawnee Mission', 'KS', '66203', '(913) 432-7548', 'http://www.animalhavenkc.org', '', '', 'Monday-Friday 11Am-6Pm Saturday-Sunday 10Am-6Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (989, 'Operation Wildlife', '11218 West 75th Street', 'Shawnee Mission', 'KS', '66214', '(913) 631-6566', 'http://www.owl-online.org', 'opwildlife@aol.com', '', 'Friday 7-10 P.m. Saturday 10-9 P.m. Sunday 10-4 P.m.', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (990, 'Helping Hands Humane Society', '2625 Northwest Rochester Road', 'Topeka', 'KS', '66617', '(785) 233-7325', 'http://www.topekahumaneshelter.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (991, 'Ulysses City - Animal Shelter', '1600 North Road I', 'Ulysses', 'KS', '67880', '(620) 356-2713', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nGolf Courses Public\n'); INSERT INTO `default_table` VALUES (992, 'Wichita Animal Shelter', '3303 North Hillside Street', 'Wichita', 'KS', '67219', '(316) 838-9623', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLost Animals Adoptions\n'); INSERT INTO `default_table` VALUES (993, 'Animal Welfare-Kansas Humane Society', '4218 South Southeast Boulevard', 'Wichita', 'KS', '67210', '(316) 524-9196', 'http://www.kshumane.org', '', '', 'Open 11 Am-6Pm,sunday-Tuesday,thursday-Saturday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (994, 'Cowley County Humane Society', '7648 222nd Road', 'Winfield', 'KS', '67156', '(620) 221-1698', 'http://www.cowleycountyhumanesociety.org', '', '', 'Tuesday-Friday Noon To 5pm Saturday 10am-2pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (995, 'Dog Pounds - Campbell County Animal Shelter', '200 Poplar Ridge Road', 'Alexandria', 'KY', '41001', '(859) 635-2819', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (996, 'Humane Society of Nelson County', '2391 New Haven Road', 'Bardstown', 'KY', '40004', '(502) 349-2082', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (997, 'Nelson County Government - Other County Offices, Animal Shelter', '2391 New Haven Road', 'Bardstown', 'KY', '40004', '(502) 348-1865', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (998, 'Harlan County - Animal Shelter', '392 Highway 840', 'Baxter', 'KY', '40806', '(606) 573-8867', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (999, 'Humane Society of Marshall County', '2044 US Highway 641 North', 'Benton', 'KY', '42025', '(270) 527-5221', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1000, 'Marshal County Animal Shelter', '839 Benton Briensburg Road', 'Benton', 'KY', '42025', '(270) 527-0954', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1001, 'Madison County Animal Shelter', '1386 Richmond Road North', 'Berea', 'KY', '40403', '(859) 986-9625', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1002, 'Humane Society Animal Shelter', '1925 Old Louisville Road', 'Bowling Green', 'KY', '42101', '(270) 842-8572', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1003, 'Bowling Green Warren County Animal Adoption Center', '1925 Old Louisville Road', 'Bowling Green', 'KY', '42101', '(270) 783-9404', 'http://www.pets.inbowlinggreen.com', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (1004, 'Bracken County Animal Shelter', '188 Hamilton Road', 'Brooksville', 'KY', '41004', '(606) 735-3475', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1005, 'Dog Pounds - Boone County Animal Control', '5643 Idlewild Road', 'Burlington', 'KY', '41005', '(859) 586-5285', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1006, 'Pendleton County Animal Shelter', '1314 Bryan Griffin Road', 'Butler', 'KY', '41006', '(859) 472-5400', 'http://www.pendletoncountyky.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1007, 'Green River Animal Shelter', '455 Appleby Drive', 'Columbia', 'KY', '42728', '(270) 385-9655', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1008, 'Kenton County Of', '1020 Mary Laidley Drive', 'Covington', 'KY', '41017', '(859) 356-7400', 'http://www.kentoncounty.org', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1009, 'Boyle County - Animal Shelter', '777 North Danville By-Pass', 'Danville', 'KY', '40422', '(859) 238-1117', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1010, 'Humane Society Inc Of Danville-Boyle County', '777 North Danville By-Pass', 'Danville', 'KY', '40422', '(859) 238-1117', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1011, 'Franklin County Humane Society', '1041 Kentucky Avenue', 'Frankfort', 'KY', '40601', '(502) 875-7297', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1012, 'Life House For Animals', '14 Fido Court', 'Frankfort', 'KY', '40601', '(502) 875-3436', 'http://www.lifehouse4animals.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1013, 'Ark Project', '1625 Louisville Road', 'Frankfort', 'KY', '40601', '(502) 226-5438', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1014, 'Animal Shelter Of Barren Glasgow', '175 Trojan Trail', 'Glasgow', 'KY', '42141', '(270) 651-7297', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1015, 'Ohio County-Government - Animal Shelter', '1582 Country Club Lane', 'Hartford', 'KY', '42347', '(270) 298-4499', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1016, 'Kentucky River Regional Animal Shelter', '194 Animal Shelter Lane', 'Hazard', 'KY', '41701', '(606) 439-4064', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1017, 'Humane Society of Henderson County', '203 Drury Lane', 'Henderson', 'KY', '42420', '(270) 826-8966', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1018, 'Safe Harboar Farm', '411 Wood Road', 'Knob Lick', 'KY', '42154', '(270) 453-3897', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1019, 'Oldham County - Maintenance', '3945 Jones Drive', 'La Grange', 'KY', '40031', '(502) 222-3192', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1020, 'Oldham County Animal Control', '3946 Jones Drive', 'La Grange', 'KY', '40031', '(502) 222-7387', 'http://www.oldhamcounty.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1021, 'Leitchfield Animal Shelter', '213 William Thomason Byu', 'Leitchfield', 'KY', '42754', '(270) 230-8839', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1022, 'London Laurel County Animal Shelter', '1697 Shelter Lane', 'London', 'KY', '40741', '(606) 864-6319', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1023, 'Kentucky Humane Society', '241 Steedly Drive', 'Louisville', 'KY', '40214', '(502) 366-3355', 'http://www.kyhumane.org', '', '', 'Day Or Evening', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLargest Selection Of Pets In The Area All Pets Vaccinated Spayed / Neutered Micro Chipped\n'); INSERT INTO `default_table` VALUES (1024, 'Kentucky Humane Society', '5759 Preston Highway', 'Louisville', 'KY', '40219', '(502) 969-7260', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nWhere Staying Is A Treat, At Two Convenient Locations, Eastpoint Pet Resort, New Facility, Decorated Deluxe Guest Rooms, Doggie Daycare, Purrfect Plaza For Cats, Full-Service Grooming, Visit Our New... (Show More)\nWhere Staying Is A Treat, At Two Convenient Locations, Eastpoint Pet Resort, New Facility, Decorated Deluxe Guest Rooms, Doggie Daycare, Purrfect Plaza For Cats, Full-Service Grooming, Visit Our New Vet Clinic Next Door, Minirosa Kennels, Spacious Boarding Areas, Convenient Location  (Show Less)\n'); INSERT INTO `default_table` VALUES (1025, 'Kentucky Humane Society', '3070 Breckenridge Lane', 'Louisville', 'KY', '40220', '(502) 479-2973', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nWhere Staying Is A Treat, At Two Convenient Locations, Eastpoint Pet Resort, New Facility, Decorated Deluxe Guest Rooms, Doggie Daycare, Purrfect Plaza For Cats, Full-Service Grooming, Visit Our New... (Show More)\nWhere Staying Is A Treat, At Two Convenient Locations, Eastpoint Pet Resort, New Facility, Decorated Deluxe Guest Rooms, Doggie Daycare, Purrfect Plaza For Cats, Full-Service Grooming, Visit Our New Vet Clinic Next Door, Minirosa Kennels, Spacious Boarding Areas, Convenient Location  (Show Less)\n'); INSERT INTO `default_table` VALUES (1026, 'Kentucky Humane Society', '6820 Bardstown Road', 'Louisville', 'KY', '40291', '(502) 762-0054', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nWhere Staying Is A Treat, At Two Convenient Locations, Eastpoint Pet Resort, New Facility, Decorated Deluxe Guest Rooms, Doggie Daycare, Purrfect Plaza For Cats, Full-Service Grooming, Visit Our New... (Show More)\nWhere Staying Is A Treat, At Two Convenient Locations, Eastpoint Pet Resort, New Facility, Decorated Deluxe Guest Rooms, Doggie Daycare, Purrfect Plaza For Cats, Full-Service Grooming, Visit Our New Vet Clinic Next Door, Minirosa Kennels, Spacious Boarding Areas, Convenient Location  (Show Less)\n'); INSERT INTO `default_table` VALUES (1027, 'Animal Care Society', '12207 Westport Road', 'Louisville', 'KY', '40245', '(502) 426-6303', 'http://www.animalcaresociety.org', 'info@animalcaresociety.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1028, 'Humane Society - Animal Shelter', '319 Dulin Street', 'Madisonville', 'KY', '42431', '(270) 821-8965', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1029, 'Mayfield Graves County Animal Shelter', '500 North 12th Street', 'Mayfield', 'KY', '42066', '(270) 251-0130', '', '', '', '6 Days a Week', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1030, 'Animal Shelter Action Society', '500 North 12th Street', 'Mayfield', 'KY', '42066', '(270) 251-0130', '', '', '', '6 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nSave A Life Adopt A Shelter Pet Donations Accepted Mon-Fri 10-4 Sat 10-2, Member-Mayfield-Graves County Chamber Of Commerce\n'); INSERT INTO `default_table` VALUES (1031, 'Maysville Mason County Animal Shelter', '301 River Drive', 'Maysville', 'KY', '41056', '(606) 564-6067', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1032, 'Campbell County Of Ny', '1989 Poplar Ridge Road', 'Melbourne', 'KY', '41059', '(859) 635-3594', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1033, 'Butler Co Fiscal Ct Animal Shelter', '463 Boat Factory Road', 'Morgantown', 'KY', '42261', '(270) 526-2694', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1034, 'Larue County Dog Warden', '5259 Mount Sherman Road', 'Mount Sherman', 'KY', '42764', '(270) 325-2276', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1035, 'Montgomery County - Animal Shelter', '115 Adena Drive', 'Mount Sterling', 'KY', '40353', '(859) 498-8751', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1036, 'Murray-Calloway County Animal Shelter', '81 Shelter Lane', 'Murray', 'KY', '42071', '(270) 759-4141', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1037, 'Daviess County - Animal Shelter', '2620 Calhoun Road', 'Owensboro', 'KY', '42301', '(270) 685-8275', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1038, 'Humane Society-Animal Shelter', '4000 Coleman Road', 'Paducah', 'KY', '42001', '(270) 443-5923', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1039, 'Paws Animal Shelter', '6 Legion Road', 'Paris', 'KY', '40361', '(859) 988-9800', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1040, 'Pike County Animal Shelter', '399 Pound Puppy Drive', 'Pikeville', 'KY', '41501', '(606) 432-6293', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1041, 'Hardin County Humane Society', '145 Park Avenue', 'Radcliff', 'KY', '40160', '(270) 352-0738', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1042, 'Cocker Spaniel Rescue', '145 Park Avenue', 'Radcliff', 'KY', '40160', '(270) 352-0763', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1043, 'Oakwood Animal Kingdom Inc', '1631 S Dixie Boulevard', 'Radcliff', 'KY', '40160', '(270) 352-4698', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1044, 'Daisy Apollo Fund For Animals', '428 N Dixie Boulevard', 'Radcliff', 'KY', '40160', '(270) 352-0763', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1045, 'Estill County Animal Shelter', '50 Ginter Road', 'Ravenna', 'KY', '40472', '(606) 723-3587', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1046, 'Logan County Humane Society', '550 Sportsman Club Road', 'Russellville', 'KY', '42276', '(270) 726-2186', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1047, 'Russell County Animal Shelter', '2870 Landfield Road', 'Russell Springs', 'KY', '42642', '(270) 866-9548', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1048, 'Allen Co-Scottsville Animal Shelter', '51 Humane Lane', 'Scottsville', 'KY', '42164', '(270) 618-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1049, 'Bullit Co Animal Shelter', '535 Clermont Road', 'Shepherdsville', 'KY', '40165', '(502) 543-7392', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1050, 'Woodford Co Animal Control', '204 Beasley Drive', 'Versailles', 'KY', '40383', '(859) 879-0598', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1051, 'Grant County Animal Shelter', '218 Barnes Road', 'Williamstown', 'KY', '41097', '(859) 824-9403', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1052, 'Leslie County Animal Shelter', '2323 Cutshin Road', 'Wooton', 'KY', '41776', '(606) 279-4803', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1053, 'Alexandria Animal Shelter', '200 Animal Shelter Road', 'Alexandria', 'LA', '71301', '(318) 473-1229', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1054, 'Bastrop City - Public Works Dept, Animal Shelter', '6878 Mer Rouge Road', 'Bastrop', 'LA', '71220', '(318) 283-0288', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1055, 'West Baton Rouge Parish - Animal Control', '553 Lobdell Avenue', 'Baton Rouge', 'LA', '70806', '(225) 336-2428', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1056, 'Paws', '9596 Highway 23', 'Belle Chasse', 'LA', '70037', '(504) 392-1601', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1057, 'Washington Humane Society', '316 South Columbia Street', 'Bogalusa', 'LA', '70427', '(985) 732-0020', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1058, 'ARF', '1011 Rue Bois De Chene', 'Breaux Bridge', 'LA', '70517', '(337) 332-4756', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1059, 'Lafayette Animal Aid', '146 Le Medicin Road', 'Carencro', 'LA', '70520', '(337) 896-1553', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nHumane Societies\n'); INSERT INTO `default_table` VALUES (1060, 'Friends Of The Animal Shelter Of St Bernard', '1095 Po Box', 'Chalmette', 'LA', '70044', '(504) 278-1535', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1061, 'Greyhound Pets of America', '106 Pine Oak Drive', 'Covington', 'LA', '70433', '(985) 893-0966', 'http://www.greyhoundpets.org', 'greyhoundpets@greyhoundpets.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1062, 'Concordia Animal Welfare Shelter', '1212 1st Street', 'Ferriday', 'LA', '71334', '(318) 757-2297', 'http://www.caws.petfinder.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nCaws, Adopt A Friend For Life, $55 Includes, Adoption, Deworm, Spay/Neuter, Training DVD, Heartworm Test, ID Tags, Bag Of Food, Vet Exam, Save Lives, Help Us Stop Killing, Please Spay Or Neuter Your... (Show More)\nCaws, Adopt A Friend For Life, $55 Includes, Adoption, Deworm, Spay/Neuter, Training DVD, Heartworm Test, ID Tags, Bag Of Food, Vet Exam, Save Lives, Help Us Stop Killing, Please Spay Or Neuter Your Pets  (Show Less)\n'); INSERT INTO `default_table` VALUES (1063, 'Town Of Franklinton - Animal Shelter', '1637 Desmare Street', 'Franklinton', 'LA', '70438', '(985) 839-5458', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1064, 'Animal Shelter', '10905 Highway 182', 'Franklin', 'LA', '70538', '(337) 828-4646', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1065, 'St Mary Parish Of', '10905 Highway 182', 'Franklin', 'LA', '70538', '(337) 828-4646', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1066, 'Animal Shelter', '131 Plant Road', 'Houma', 'LA', '70363', '(985) 873-6709', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1067, 'St John Parish Animal Shelter', '124 Waterplant Road', 'La Place', 'LA', '70068', '(985) 651-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1068, 'Vernon Parish Animal Shelter', '272 J L Obanion Road', 'Leesville', 'LA', '71446', '(337) 392-9613', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1069, 'St Charles Humane Society', '13875 Frere Street', 'Luling', 'LA', '70070', '(985) 785-9136', 'http://www.stcharleshumanesociety.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1070, 'Jefferson Parish Animal Shelter', '1869 Ames Boulevard', 'Marrero', 'LA', '70072', '(504) 349-5111', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAdoption Of Dogs And Cats, Sheltering Of Lost Pets, Bite Case Investigations\n'); INSERT INTO `default_table` VALUES (1071, 'Animal Adoption Society Inc', '2545 Paul Street', 'Meraux', 'LA', '70075', '(504) 276-7387', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1072, 'Iberia Parish - Parish Government, Animal Shelter', '2017 Seaway Access Road', 'New Iberia', 'LA', '70560', '(337) 364-6311', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1073, 'Sugarena At Acadiana Fairgrounds', '713 By-Pass Highway', 'New Iberia', 'LA', '70560', '(337) 365-7539', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1074, 'SPCA Louisiana', '701 Thayer Street', 'New Orleans', 'LA', '70114', '(504) 368-5191', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1075, 'New Orleans City - Addtional City Listings, SPCA', '1319 Japonica Street', 'New Orleans', 'LA', '70117', '(504) 944-7445', 'http://www.la-spca.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1076, 'SPCA Louisiana', '1319 Japonica Street', 'New Orleans', 'LA', '70117', '(504) 944-7445', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1077, 'Jefferson Parish Animal Shelter', '1 Humane Way', 'New Orleans', 'LA', '70123', '(504) 736-6111', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAdoptions Of Dogs & Cats, Sheltering Of Lost Pets, Bite Case Investigations\n'); INSERT INTO `default_table` VALUES (1078, 'Ark La Tex Horse Rescue', '14401 Highway 538', 'Oil City', 'LA', '71061', '(318) 995-6808', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1079, 'Slidell Animal Shelter', '2700 Terrace Avenue', 'Slidell', 'LA', '70458', '(985) 646-4267', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nGovernment Offices-City, Village & Township\n'); INSERT INTO `default_table` VALUES (1080, 'Ascension Parish Animal Shelter', '9894 Airline Highway', 'Sorrento', 'LA', '70778', '(225) 675-6557', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1081, 'Winnfield City - Animal Shelter', '508 South Beville Street', 'Winnfield', 'LA', '71483', '(318) 628-2193', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1082, 'Tek Pets & Supplies', '21 Ames Road', 'Alna', 'ME', '04535', '(207) 882-7879', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPets Are Our Business, ~We Are The Best Home Away From Home For Your Pets~, 16 Run Canine Boarding Facility W/Radiant Heat Covered Run & 24 Hour Kennel Cam, Pet Daycare & Pet Sitting, Grooming &... (Show More)\nPets Are Our Business, ~We Are The Best Home Away From Home For Your Pets~, 16 Run Canine Boarding Facility W/Radiant Heat Covered Run & 24 Hour Kennel Cam, Pet Daycare & Pet Sitting, Grooming & Microchipping, Boarding For Felines & Feathered Friends, Breeders Of Alaskan Malamutes & Siberian Husky, Breeders Of Exotic Bird  (Show Less)\n'); INSERT INTO `default_table` VALUES (1083, 'Trails End Kennel', '21 Ames Road', 'Alna', 'ME', '04535', '(207) 882-7879', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1084, 'Greater Androscoggin Humane Society - Shelter', '420 Poland Road', 'Auburn', 'ME', '04210', '(207) 783-2311', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1085, 'Town Line Animal Shelter', '46 Baker Road', 'Belfast', 'ME', '04915', '(207) 338-1403', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1086, 'Save Our Strays', '41 Wyman Road', 'Benton', 'ME', '04901', '(207) 877-0060', 'http://www.saveourstraysinmaine.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1087, 'Chesapeake Safe Harbor Inc', '113 Waldoboro Road', 'Bremen', 'ME', '04551', '(207) 529-4511', 'http://www.chesapeakesafeharbor.com', '', '', 'Daily 8:00Am-10:00Am,4:00Pm-5:00Pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (1088, 'Coastal Humane Society Inc', '30 Range Road', 'Brunswick', 'ME', '04011', '(207) 725-5051', 'http://www.coastalhumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1089, 'Paws Humane Society', '84 South Street', 'Calais', 'ME', '04619', '(207) 454-7662', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1090, 'Ark Animal Shelter', '60 Barber Lane', 'Cherryfield', 'ME', '04622', '(207) 546-3484', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1091, 'Boothbay Region Humane Society', '27 Atlantic Highway', 'Edgecomb', 'ME', '04556', '(207) 882-9677', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1092, 'Lincoln County Animal Shelter', '27 Atlantic Highway', 'Edgecomb', 'ME', '04556', '(207) 882-9677', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1093, 'Maine Friends of Animals', '190 US Route 1', 'Falmouth', 'ME', '04105', '(207) 781-2187', 'http://www.mfoa.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1094, 'Humane Society Shelter', '263 Callaghan Road', 'Houlton', 'ME', '04730', '(207) 532-2862', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1095, 'Penobscot Valley Humane Society', '1 Park Avenue', 'Lincoln', 'ME', '04457', '(207) 794-3457', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1096, 'My Wonderful Dog', '54 Cove Street', 'Portland', 'ME', '04101', '(207) 780-9792', 'http://www.wonderfuldogs.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nIndividual and group obedience classes, Assistance dogs for people with disabilities, Puppy Play Group, Teen Summer Camps, Training Seminars\n'); INSERT INTO `default_table` VALUES (1097, 'Maine Animal Coalition', '1 Pleasant Street', 'Portland', 'ME', '04101', '(207) 773-2215', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Protection Organizations\n'); INSERT INTO `default_table` VALUES (1098, 'Friends of Feral Felines', '10 Farragut Street', 'Portland', 'ME', '04103', '(207) 797-3014', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1099, 'The Pet Nanny', '1806 Washington Ave', 'Portland', 'ME', '04103', '(207) 415-6880', 'http://www.thepetnanny.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDiscounts For Medical Conditions, Senior Citizen Discounts\n'); INSERT INTO `default_table` VALUES (1100, 'Camden Rockport Animal Rescue League Sexton Animal Shelter', '146 Camden', 'Rockland', 'ME', '04841', '(207) 236-8702', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1101, 'Sabattus Animal Shelter', '26 Pleasant Hill Road', 'Sabattus', 'ME', '04280', '(207) 375-8753', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1102, 'Southwest Harbor Animal Shelter', '15 Wood Street', 'Southwest Harbor', 'ME', '04679', '(207) 244-3749', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1103, 'Precious Paws Rescue & Adoption Inc.', '15 Main Street', 'Van Buren', 'ME', '04785', '(207) 868-2828', 'http://www.sjvnews.com/preciouspaws/', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n'); INSERT INTO `default_table` VALUES (1104, 'Humane Society Waterville Area', '120 Drummond Avenue', 'Waterville', 'ME', '04901', '(207) 873-2430', 'http://www.hswa.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1105, 'Animal Refuge League', '449 Stroudwater Street', 'Westbrook', 'ME', '04092', '(207) 854-9771', 'http://www.arlgp.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1106, 'Maine State Society for the Protection of Animals', '279 River Road', 'Windham', 'ME', '04062', '(207) 892-8007', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1107, 'Humane Society Of Baltimore County-Shelter', '1601 Nicodemus Road', 'Reisterstown', 'MD', '21136', '(410) 833-8848', 'http://www.hsbcanimals.org', '', 'Adopt Your Animal Today. Dogs, Cats, And Rabbits Available.', '', '\nProducts & Services:
\n\n
Additional Information:
\nAdoptions-Dogs & Cats, Spay / Neuter Center - Pet Cemetery, We Accept Donated Cars/Trucks\n'); INSERT INTO `default_table` VALUES (1108, 'Maryland SPCA', '3300 Falls Road', 'Baltimore', 'MD', '21211', '(410) 235-8826', 'http://www.mdspca.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nGift Shop/Pet Supplies, Neuter Scooter (Mobile Spay/Neuter Clinic)410-889-SPAY\n'); INSERT INTO `default_table` VALUES (1109, 'SPCA', '1815 Bay Ridge Avenue', 'Annapolis', 'MD', '21403', '(410) 268-4388', 'http://www.aacspca.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt A Homeless Animal, A Private Non-Profit Animal Shelter, Caring For Animals Since 1920, Purebred And Mixed Breed Dogs Cats And Rabbits Looking For Loving Homes, Car And Boat Donations Welcome\n'); INSERT INTO `default_table` VALUES (1110, 'SPCA Car & Boat Program', '1815 Bay Ridge Av', 'Annapolis', 'MD', '21405', '(410) 263-0000', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1111, 'Maryland SPCA', '3300 Falls Road', 'Baltimore', 'MD', '21211', '(410) 235-8826', 'http://www.mdspca.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nGift Shop/Pet Supplies, Neuter Scooter (Mobile Spay/Neuter Clinic)410-889-SPAY\n'); INSERT INTO `default_table` VALUES (1112, 'Maryland SPCA', '3300 Falls Road', 'Baltimore', 'MD', '21211', '(410) 889-7729', 'http://www.mdspca.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPet Adoptions Pet Behavior Advice, Gift Shop/Pet Supplies, Neuter Scooter (Mobile Spay/Neuter Clinic\n'); INSERT INTO `default_table` VALUES (1113, 'Alley Cat Rescue', '3904 Rhode Island Avenue', 'Brentwood', 'MD', '20722', '(301) 277-5595', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1114, 'Bo''s Pet Parlor', '6 Winters Lane', 'Catonsville', 'MD', '21228', '(410) 788-3366', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1115, 'Kent County - Humane Society', '10720 Augustine Herman Highway', 'Chestertown', 'MD', '21620', '(410) 778-3648', 'http://www.kenthumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1116, 'Handy Numbers At A Glance - Animal Welfare Society Of Howard County', '8556 Davis Road', 'Columbia', 'MD', '21045', '(410) 465-4350', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1117, 'Somerset Animal Welfare Society Inc', '26840 Old State Road', 'Crisfield', 'MD', '21817', '(410) 968-3457', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1118, 'Duvall Law Firm Llc', '2411 Crofton Lane', 'Crofton', 'MD', '21114', '(410) 721-1660', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1119, 'Frisky''s Wildlife & Primate Sanctuary & Rescue', '10790 Old Frederick Road', 'Ellicott City', 'MD', '21043', '(410) 418-8899', 'http://www.friskys.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nSaving Lives Of Wildlife Since 1970, Federal & State Licensed Master Wildlife Rehabilitator, USDA Licensed Exhibitor Nonprofit Organization, A 501 (c) 3 Organization\n'); INSERT INTO `default_table` VALUES (1120, 'Weimaraner Rescue', '17301 Germantown Road', 'Germantown', 'MD', '20874', '(301) 428-0452', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1121, 'Columbia Dog Pound', '7653 Clark Road', 'Hanover', 'MD', '21076', '(410) 551-0581', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1122, 'Rude Ranch Animal Rescue', '3200 Ivy Way', 'Harwood', 'MD', '20776', '(410) 798-9559', 'http://www.ruderanch.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1123, 'Earnhart Kennel', '1201 Brandy Spring Road', 'Parkton', 'MD', '21120', '(410) 329-6464', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1124, 'Defenders Of Animal Rights Inc', '14412 Old York Road', 'Phoenix', 'MD', '21131', '(410) 527-1466', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1125, 'Adopt-A-Pet', '14412 Old York Road', 'Phoenix', 'MD', '21131', '(410) 527-1466', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1126, 'Humane Society Of Baltimore County-Shelter', '1601 Nicodemus Road', 'Reisterstown', 'MD', '21136', '(410) 833-8848', 'http://www.hsbcanimals.org', '', 'Adopt Your Animal Today. Dogs, Cats, And Rabbits Available.', '', '\nProducts & Services:
\n\n
Additional Information:
\nAdoptions-Dogs & Cats, Spay / Neuter Center - Pet Cemetery, We Accept Donated Cars/Trucks\n'); INSERT INTO `default_table` VALUES (1127, 'Carroll County - Humane Society', '2517 Littlestown Pike', 'Westminster', 'MD', '21158', '(410) 848-4810', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1128, 'Public Agencies - Dog Licenses Humane Society, Humane Society Animal Control', '2517 Littlestown Pike', 'Westminster', 'MD', '21158', '(410) 848-4810', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1129, 'Carroll County Humane Society Inc', '2517 Littlestown Pike', 'Westminster', 'MD', '21158', '(410) 848-4810', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1130, 'Wild Life Rehabilitation', '10790 Old Frederick Road', 'Woodstock', 'MD', '21163', '(410) 465-5527', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1131, 'New England Animal Action Inc', '59 Arnold Road', 'Amherst', 'MA', '01002', '(413) 256-3437', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1132, 'Attleboro Friends Of Cats Shelter Inc', '8 North Main Street', 'Attleboro', 'MA', '02703', '(508) 431-6700', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1133, 'Belmont Animal Hospital', '820 Pleasant Street', 'Belmont', 'MA', '02478', '(617) 484-5197', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1134, 'Feld Randall G Dr', '820 Pleasant Street', 'Belmont', 'MA', '02478', '(617) 484-5197', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1135, 'M SPCA', '350 South Huntington Avenue', 'Boston', 'MA', '02130', '(617) 442-2816', 'http://www.mspca.org', '', '', '24 Hours/7 Days', '\nProducts & Services:
\n\n
Additional Information:
\nMSPCA Administrative Offices, REFERRAL HOSPITAL, A Full Service Hospital\n'); INSERT INTO `default_table` VALUES (1136, 'Anti-Vivisection Society of America', '11 Beacon Street Suite 1105', 'Boston', 'MA', '02108', '(617) 227-8647', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1137, 'New England Anti-Vivisection Society Neavs', '333 Washington Street', 'Boston', 'MA', '02108', '(617) 523-6020', 'http://www.neavs.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1138, 'Animal Rescue League', '10 Chandler Street', 'Boston', 'MA', '02116', '(617) 426-9170', 'http://www.arlboston.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nHelping Animals Since 1899, Pet Adoption Centers, Veterinary Clinics, Law Enforcement, Pet Cemetery, Call Centers For Adoption Hours\n'); INSERT INTO `default_table` VALUES (1139, 'Alliance for Animals Mobile Action Clinic', '232 Silver Street', 'Boston', 'MA', '02127', '(617) 268-7800', 'http://www.afa.arlington.ma.us', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1140, 'Animal Rescue League of Boston', '3981 Main Street', 'Brewster', 'MA', '02631', '(508) 255-1030', 'http://www.arlboston.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPET ADOPTION CENTERS, VET CLINICS AND PET CEMETERY, INSPECTION AND ENFORCEMENT, Boston, Dedham, Pembroke\n'); INSERT INTO `default_table` VALUES (1141, 'Brighton Animal Hospital', '503 Western Ave', 'Brighton', 'MA', '02135', '(617) 787-1500', 'http://www.brightonanimalhospital.com', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nComplete Medical & Surgical Services, Diagnostics Radiology Dentistry, Prescription & Best Quality Diets\n'); INSERT INTO `default_table` VALUES (1142, 'Callanan Kevin Veterinarian', '503 Western Avenue', 'Brighton', 'MA', '02135', '(617) 787-1500', 'http://www.brightonanimalhospital.com', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nDiagnostics Radiology Dentistry, Providing Complete Medical & Surgical Services, Prescription & Highest Quality Diets Available, Grooming & Boarding, Full Line Of Pet Supplies, Union Square Vet Clinic\n'); INSERT INTO `default_table` VALUES (1143, 'Mspca', '1300 West Elm Street Extension', 'Brockton', 'MA', '02301', '(508) 586-2053', '', 'mspca@nantucket.net', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1144, 'Massachusetts Society For The Prevention Of Cruelty To Animals', '1300 West Elm Street Extension', 'Brockton', 'MA', '02301', '(508) 586-2053', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1145, 'Burlington Vet Hospital', '64 Middlesex Turnpike', 'Burlington', 'MA', '01803', '(781) 270-0044', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (1146, 'Burlington Vet Hospital', '64 Middlesex Turnpike', 'Burlington', 'MA', '01803', '(781) 270-0078', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nVeterinary Clinics & Hospitals\n'); INSERT INTO `default_table` VALUES (1147, 'Burlington Vet Hospital', '64 Middlesex Turnpike', 'Burlington', 'MA', '01803', '(781) 270-4099', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nVeterinary Clinics & Hospitals\n'); INSERT INTO `default_table` VALUES (1148, 'Burlington Vet Hospital', '64 Middlesex Turnpike', 'Burlington', 'MA', '01803', '(781) 270-5657', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nVeterinary Clinics & Hospitals\n'); INSERT INTO `default_table` VALUES (1149, 'Burlington Vet Hospital', '64 Middlesex Turnpike', 'Burlington', 'MA', '01803', '(781) 270-6754', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nVeterinary Clinics & Hospitals\n'); INSERT INTO `default_table` VALUES (1150, 'National Marine Life Center', '120 Main Street', 'Buzzards Bay', 'MA', '02532', '(508) 743-9888', 'http://www.nmlc.org', '', 'www.nmlc.org', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1151, 'Cape Cod Stranding Network Inc - Office', '120 Main Street', 'Buzzards Bay', 'MA', '02532', '(508) 743-9805', 'http://www.capecodstranding.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1152, 'Mass Society Prevention Cruelty To Animals', '1577 Falmouth Road', 'Centerville', 'MA', '02632', '(508) 775-0940', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1153, 'Mspca Animal Shelter', '1577 Falmouth Road', 'Centerville', 'MA', '02632', '(508) 775-0940', 'http://www.mspca.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1154, 'Scotty''s Pet Sitting Service', '661 East St', 'Dalton', 'MA', '01226', '(413) 684-3835', '', '', 'We Come To Your Home To Feed,Clean Up, Walk, & Play With Your Pet.', '', '\nProducts & Services:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nReasonable Rates, Reliable, By Appointment Only\n'); INSERT INTO `default_table` VALUES (1155, 'Strays in Need Inc', '281 Locust Street', 'Danvers', 'MA', '01923', '(978) 774-1409', 'http://www.straysinneed.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1156, 'Animal Rescue League Of New Bedford', '31 Ventura Drive', 'Dartmouth', 'MA', '02747', '(508) 995-0848', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1157, 'Animal Rescue League Of Boston', '55 Annas Place', 'Dedham', 'MA', '02026', '(781) 326-0729', 'http://www.arlsboston.org', 'info@arlboston.org', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1158, 'Pine Ridge Animal Center', '55 Annas Place', 'Dedham', 'MA', '02026', '(781) 326-0729', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1159, 'Safford Memorial', '55 Annas Place', 'Dedham', 'MA', '02026', '(781) 326-0729', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1160, 'Dudley Town - Animal Shelter', '11 Indian Road', 'Dudley', 'MA', '01571', '(508) 949-8024', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1161, 'Standish Humane Society', '622 Congress Street', 'Duxbury', 'MA', '02332', '(781) 834-4663', 'http://www.standishhumanesociety.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1162, 'Wild Care', '10 Smith Lane', 'Eastham', 'MA', '02642', '(508) 240-2255', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nCape Cod''s Independent Wildlife Clinic Helping Sick Injured Or Orphaned Wildlife\n'); INSERT INTO `default_table` VALUES (1163, 'Second Chance Animal Shelter', '113 Young Road', 'East Brookfield', 'MA', '01515', '(508) 867-5525', 'http://secondchanceanimals.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1164, 'Friends of Falmouth Dogs', '150 Blacksmith Shop Road', 'East Falmouth', 'MA', '02536', '(508) 548-7742', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1165, 'Mass Society for the Prevention of Cruelty To Animals', '276 Vineyard Haven Road', 'Edgartown', 'MA', '02539', '(508) 627-8662', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1166, 'Faxon Animal Rescue League', '474 Durfee Street', 'Fall River', 'MA', '02720', '(508) 676-1061', '', '', '', 'Open Tuesday Wednesday Friday Saturday 10:00Am-5:00Pm Thursday 12:00Pm-7:00Pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdoption/Shelter Services, Dogs-Cats-Puppies-Kittens-Small Animals, Obedience Lessons, Low Cost Spay/Neuter And Vaccination Clinic, Pet Supplies\n'); INSERT INTO `default_table` VALUES (1167, 'Homes & Rights For Animals', '50 Beacon', 'Fall River', 'MA', '02720', '(508) 679-8418', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Protection Organizations\n'); INSERT INTO `default_table` VALUES (1168, 'Gardner City - Fire Dept, Animal Shelter', '95 Pleasant Street', 'Gardner', 'MA', '01440', '(978) 630-4950', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1169, 'Cape Ann Animal Aid Associates Inc', '260 Main Street', 'Gloucester', 'MA', '01930', '(978) 283-6055', 'http://www.capeannanimalaid.petfinder.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1170, 'Pioneer Valley Humane Society', '155 French King Highway', 'Greenfield', 'MA', '01301', '(413) 773-3148', 'http://www.petz.org', '', '', 'Mon-Fri: 07:00am-05:00pm', '\nSpecialties:
\n\n
Additional Information:
\nHumane Education Programs, Advice & Information Line\n'); INSERT INTO `default_table` VALUES (1171, 'Greyhound Friends Inc', '167 Saddle Hill Rd', 'Hopkinton', 'MA', '01748', '(508) 435-5969', 'http://www.ameurogreyhoundalliance.org', 'bobcarson@greyhound.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1172, 'American Humane Education Society', '350 South Huntington Avenue', 'Jamaica Plain', 'MA', '02130', '(617) 522-5055', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1173, 'Boston Animal Shelter', '350 South Huntington Avenue', 'Jamaica Plain', 'MA', '02130', '(617) 522-5055', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1174, 'Nashoba Valley Humane Society', '505 Center Bridge Road', 'Lancaster', 'MA', '01523', '(978) 365-9470', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1175, 'Dakin Pioneer Valley Humane Society', '163 Montague Road', 'Leverett', 'MA', '01054', '(413) 548-9898', 'http://www.dakinshelter.org', 'info@dakinshelter.org', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1176, 'Dakin Animal Shelter', '163 Montague Road', 'Leverett', 'MA', '01054', '(413) 548-9898', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1177, 'Merrimack Valley Animal Shelter', '951 Broadway Street', 'Lowell', 'MA', '01854', '(978) 452-7781', 'http://www.lowellhumanesociety.org', '', 'Serving the Merrimack Valley Since 1873', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nThe Lowell Humane Society, All Donations Are Used To Support The, Lowell Humane Society\n'); INSERT INTO `default_table` VALUES (1178, 'Greyhound Rescue of N E Inc', '200 Providence Street', 'Mendon', 'MA', '01756', '(508) 478-1617', 'http://www.greyhoundrescuene.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1179, 'Massachusetts Society For The Prevention Of Cruelty To Animals - Nevins Farm & Equine Center', '400 Broadway', 'Methuen', 'MA', '01844', '(978) 687-0056', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1180, 'Hillside Acre Animal Cemetary & Crematory', '400 Broadway', 'Methuen', 'MA', '01844', '(978) 687-7453', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1181, 'M S P C A''S Pet Cemetery', '400 Broadway', 'Methuen', 'MA', '01844', '(978) 687-7453', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1182, 'Nevins Farm and Equine Centre', '400 Broadway', 'Methuen', 'MA', '01844', '(978) 687-7453', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1183, 'Massachusetts Society For The Prevention Of Cruelty To Animals - Small Animal Shelter', '400 Broadway', 'Methuen', 'MA', '01844', '(978) 687-2402', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1184, 'MSPCA', '400 Broadway', 'Methuen', 'MA', '01844', '(978) 687-7453', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1185, 'Massachusetts Society For The Prevention Of Cruelty To Animals', '400 Broadway', 'Methuen', 'MA', '01844', '(978) 687-7453', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1186, 'Milford Humane Society', '289 West Street', 'Milford', 'MA', '01757', '(508) 473-7008', 'http://www.milfordhumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1187, 'North Adams Animal Shelter', '1040 Reservoir Road', 'North Adams', 'MA', '01247', '(413) 664-4442', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1188, 'Kempton Memorial', '31 Ventura Drive', 'North Dartmouth', 'MA', '02747', '(508) 995-6661', '', '', 'Kempton Memorial - Humane Society South Coast- Animal Resuce League of New Bedford', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1189, 'Norton Town - Animal Shelter And Control', '84 Hill Street', 'Norton', 'MA', '02766', '(508) 286-2655', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1190, 'Friends Of Peabody Animal Shelter & Rescue', '24 North Central Street', 'Peabody', 'MA', '01960', '(978) 531-7478', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1191, 'Peabody Animal Rescue & Shelter', '6 Allens Lane', 'Peabody', 'MA', '01960', '(978) 536-7080', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1192, 'Animal Rescue League Of Boston', '599 Washington Street', 'Pembroke', 'MA', '02359', '(781) 826-6140', 'http://www.arlboston.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nHelping Animals Since 1899, Pet Adoption Centers, Veterinary Clinics, Law Enforcement, Pet Cemetery, Call Centers For Adoption Hours\n'); INSERT INTO `default_table` VALUES (1193, 'Creations', '14 Dalton Avenue', 'Pittsfield', 'MA', '01201', '(413) 442-4442', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1194, 'Soncini Eleanor Animal Shelter', '63 Downing Industrial P', 'Pittsfield', 'MA', '01201', '(413) 448-9800', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1195, 'Berkshire Humane Society', '214 Barker Road', 'Pittsfield', 'MA', '01201', '(413) 447-7878', 'http://www.berkshirehumane.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nADOPTIONS/SURRENDERS, FAMILY DOG SCHOOL, PET FOOD BANK, SPAY/NEUTER PROGRAM\n'); INSERT INTO `default_table` VALUES (1196, 'Love Your Pet', '308 Court Street', 'Plymouth', 'MA', '02360', '(508) 747-6767', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1197, 'CASAS', '5 Sandy Hill Lane', 'Provincetown', 'MA', '02657', '(508) 487-4243', 'http://www.casasanimalshelter.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1198, 'Boston City - Animal Shelter And Adoption Center', '26 Mahler Road', 'Roslindale', 'MA', '02131', '(617) 635-1800', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1199, 'Boston City - Animal Shelter And Adoption Center', '26 Mahler Road', 'Roslindale', 'MA', '02131', '(617) 635-1913', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1200, 'Paws With A Cause', '239 Main Street', 'Rowley', 'MA', '01969', '(978) 948-7980', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1201, 'Sweet Pea Friends Of Rutland Animals', '338 Pommogussett Road', 'Rutland', 'MA', '01543', '(508) 886-6191', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1202, 'Northeast Animal Shelter', '204 Highland Avenue', 'Salem', 'MA', '01970', '(978) 745-9888', 'http://www.northeastanimalshelter.org', '', 'To Shelter, Spay Or Neuter, and Place Homeless Dogs And Cats In Permanent Homes.', 'Mon-Fri: 09:00am-09:00pm
Sat-Sun: 09:00am-06:00pm', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nAdopt Pups & Kittens, Low Cost Spay Free Shot\n'); INSERT INTO `default_table` VALUES (1203, 'Merrimack River Feline Rescue Society Inc', '63 Elm Street', 'Salisbury', 'MA', '01952', '(978) 462-0760', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1204, 'Brighton Animal Hospital', '37 Union Square', 'Somerville', 'MA', '02143', '(617) 628-2644', 'http://www.brightonanimalhospital.com', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nDiagnostics Radiology Dentistry, Providing Complete Medical & Surgical Services, Prescription & Highest Quality Diets Available, Grooming & Boarding, Full Line Of Pet Supplies\n'); INSERT INTO `default_table` VALUES (1205, 'Sterling Animal Shelter Inc', '17 Laurelwood Road', 'Sterling', 'MA', '01564', '(978) 422-8585', 'http://www.sterlingshelter.org', '', '', 'Mon-Fri: 11:00 AM-06:00 PM
Sat 10:00 AM-04:00 PM', '\nProducts & Services:
\n\n
Brands:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n
Additional Information:
\nWe Want You To Build A Relationship With Your New Pet, Based On Trust & Commitment, Just As Much As Your Potential Pet Does.\n'); INSERT INTO `default_table` VALUES (1206, 'Buddy Dog Humane Society Inc', '151 Boston Post Road', 'Sudbury', 'MA', '01776', '(978) 443-6990', 'http://www.buddydoghs.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (1207, 'Animal Health Center Inc', '2245 Providence Highway', 'Walpole', 'MA', '02081', '(508) 660-9956', 'http://www.animalhealthcenter.net', '', 'Please Click The "Business Profile" Link Below For More Information', 'Mon 09:00am-05:00pm
Tue-Thu: 07:30am-07:30pm
Fri 09:00am-05:00pm
Sat 09:00am-12:00pm', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (1208, 'Cape Wildlife Center', '185 Meadow Lane', 'West Barnstable', 'MA', '02668', '(508) 362-0111', 'http://www.capewildlife.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nWildlife Only\n'); INSERT INTO `default_table` VALUES (1209, 'Pet Pals Of Winchester', '37 Tufts Road', 'Winchester', 'MA', '01890', '(781) 721-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1210, 'Ford''s Hometown Services', '549 Grove Street', 'Worcester', 'MA', '01605', '(508) 476-1966', 'http://www.fordshometown.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nYour Environmental Pest Managers, Home Of The Pest Of The Month, Carpenter Ants, Termites, VA/FHA Inspections, Mice/Rodents, Bees/Wasps, Roaches, Spiders, Componotus, Herculeanus, Pennsylvanicus,... (Show More)\nYour Environmental Pest Managers, Home Of The Pest Of The Month, Carpenter Ants, Termites, VA/FHA Inspections, Mice/Rodents, Bees/Wasps, Roaches, Spiders, Componotus, Herculeanus, Pennsylvanicus, Fleas / Ticks, Kitchen Pests, Files, Moths, Beetles, All Household Pests, Problem Animals, Pest Control & Termite Control Specialists, Preventative Maintenance Plans Available, New Ask About Our Lawn Division & Complete 5 Step Fertilization Program, Complete Home Inspections, Locally Owned & Family Operated Since 1910, Visit Our Website For Our Coupon Offer  (Show Less)\n'); INSERT INTO `default_table` VALUES (1211, 'Greater Worcester Friends Of The Homeless Inc', '11 Ashmont Avenue', 'Worcester', 'MA', '01610', '(508) 755-5837', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1212, 'Allegan County Of', '2283 33rd Street', 'Allegan', 'MI', '49010', '(269) 673-8879', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1213, 'Shelter Association Of Washtenaw County', '312 W Huron Street', 'Ann Arbor', 'MI', '48103', '(734) 662-2829', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1214, 'Bird Center of Washtenaw County', '926 Mary Street', 'Ann Arbor', 'MI', '48104', '(734) 761-9640', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1215, 'Ambulance Service-Lake County', '723 West Wash Avenue', 'Baldwin', 'MI', '49304', '(231) 745-2711', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1216, 'Battle Creek Animal Shelter', '29 Hoag Street', 'Battle Creek', 'MI', '49014', '(269) 660-8064', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1217, 'Calhoun County Animal Shelter', '165 Union Street South', 'Battle Creek', 'MI', '49014', '(269) 963-6582', '', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1218, 'Haven Of Rest Ministries', '11 Green Street', 'Battle Creek', 'MI', '49014', '(269) 565-0213', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1219, 'Humane Soc-Calhoun Area', '2500 Watkins Road', 'Battle Creek', 'MI', '49015', '(269) 963-1796', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1220, 'Animal Aid', '134 Eastern Avenue', 'Benton Harbor', 'MI', '49022', '(269) 934-7729', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1221, 'Humane Society Of Sw Mi', '641 South Crystal Avenue', 'Benton Harbor', 'MI', '49022', '(269) 927-3303', '', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Additional Information:
\nA 501 C 3 Non-Profit Org\n'); INSERT INTO `default_table` VALUES (1222, 'Berrien County Animal Shelter', '9204 Huckleberry Road', 'Berrien Center', 'MI', '49102', '(269) 471-7531', 'http://www.berriencounty.org', '', '', 'Mon-Fri/Weekdays', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt A Pet, Dog, Kittens - Adoptions, Spay / Neuter Discounts, Minimal Fee\n'); INSERT INTO `default_table` VALUES (1223, 'Dog Pound', '9204 Huckleberry Road', 'Berrien Center', 'MI', '49102', '(269) 471-7531', '', '', '', 'Open Mon-Fri', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1224, 'Luckies Exotic Pet Shelter', '826 Marion', 'Big Rapids', 'MI', '49307', '(231) 592-5580', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1225, 'Mecosta County Animal Shelter', '15990 McKinley Road', 'Big Rapids', 'MI', '49307', '(231) 796-1331', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1226, 'Charlevoix County Animal Control', '614 Beardsley Street', 'Boyne City', 'MI', '49712', '(231) 582-6667', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1227, 'Charlevoix County Humane Society', '614 Beardsley Street', 'Boyne City', 'MI', '49712', '(231) 582-6774', '', 'cchs@twin-valley.net', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1228, 'Care', '2105 South Center Road', 'Burton', 'MI', '48519', '(810) 239-3567', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1229, 'Phyllis'' Olde House Antiques', '7803 South 45 Road', 'Cadillac', 'MI', '49601', '(231) 775-7502', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1230, 'Tuscola County Animal Shelter', '2738 West Caro Road', 'Caro', 'MI', '48723', '(989) 672-3863', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1231, 'St Clair County Humane Society', '6266 Lapeer Road', 'Clyde', 'MI', '48049', '(810) 987-4357', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1232, 'U S Fish & Wildlife Service', '975 South Main Street', 'Custer', 'MI', '49405', '(231) 757-3275', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Protection Organizations\n'); INSERT INTO `default_table` VALUES (1233, 'Cruelty Investigation Divison of the Michigan Humane Society', '7401 Chrysler Drive', 'Detroit', 'MI', '48211', '(313) 872-3401', '', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1234, 'Michigan Humane Society - Shelters, Rescue', '7401 Chrysler Drive', 'Detroit', 'MI', '48211', '(313) 872-0026', '', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1235, 'Michigan Humane Society Shelter', '7401 Chrysler Drive', 'Detroit', 'MI', '48211', '(313) 872-3400', 'http://www.michiganhumane.org', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Additional Information:
\nHumane Societies, Animal Shelters, Pet Shops\n'); INSERT INTO `default_table` VALUES (1236, 'Effective Alternatives For Community Housing', '1876 E Grand Boulevard', 'Detroit', 'MI', '48211', '(313) 267-1515', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1237, 'Mother Rosalind Foundation', '4369 Buckingham Avenue', 'Detroit', 'MI', '48224', '(313) 882-2440', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1238, 'Velez Shelter Center', '1514 Washington Boulevard', 'Detroit', 'MI', '48226', '(313) 963-2055', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1239, 'Fortunate Feline Adoption League', '16013 Wilson Avenue', 'Eastpointe', 'MI', '48021', '(586) 563-1738', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1240, 'Wildside Rehabilitation & Education Center', '8601 Houston Road', 'Eaton Rapids', 'MI', '48827', '(517) 663-6153', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1241, 'Thumb Animal Shelter', '2260 South Elkton Road', 'Elkton', 'MI', '48731', '(989) 375-4204', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1242, 'Delta County - Animal Shelter', '1639 17th Avenue South # 4', 'Escanaba', 'MI', '49829', '(906) 789-0230', 'http://www.deltacountymi.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1243, 'Backdoor Friends Purebred Cat Rescue', '35562 Grand River Avenue', 'Farmington', 'MI', '48335', '(248) 442-0259', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1244, 'Royer''s Antiques', '8998 East 34 Road', 'Fife Lake', 'MI', '49633', '(231) 779-2434', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1245, 'Pet Angel Adoption & Rescue Inc', '380 List Street', 'Frankenmuth', 'MI', '48734', '(989) 652-0552', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1246, 'Bellwether Foundation', '7645 West 48th Street', 'Fremont', 'MI', '49412', '(231) 924-9230', 'http://www.bellwetherharbor.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1247, 'Bellwether Harbor', '7645 W 48th Street', 'Fremont', 'MI', '49412', '(231) 924-9230', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1248, 'Otsego County - Animal Shelter', '200 East 7th Street', 'Gaylord', 'MI', '49735', '(989) 705-7632', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1249, 'Humane Society', '6266 Lapeer Road', 'Goodells', 'MI', '48027', '(810) 987-4357', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1250, 'Freedom House Ministries', '243 Southeast 68th Street', 'Grand Rapids', 'MI', '49548', '(616) 774-8606', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1251, 'Kent County - Animal Shelter, Lost Pets Adoptions', '711 Ball Avenue Northeast', 'Grand Rapids', 'MI', '49503', '(616) 336-3209', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1252, 'Kent County - Animal Shelter, General Information Licensing', '711 Ball Avenue Northeast', 'Grand Rapids', 'MI', '49503', '(616) 336-3208', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1253, 'Animal Shelter of Crawford County', '508 Huron Street', 'Grayling', 'MI', '49738', '(989) 348-4117', 'http://www.ascc.petfinder.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1254, 'Michigan Anti-Cruelty Society', '13569 Joseph Campau Street', 'Hamtramck', 'MI', '48212', '(313) 891-7188', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1255, 'Michigan Anti-Cruelty Society', '13569 Joseph Campau Street', 'Hamtramck', 'MI', '48212', '(313) 368-1564', '', '', '', '', '\nAdditional Information:
\nHumane Societies, Animal Shelters, Animal Protection Organizations\n'); INSERT INTO `default_table` VALUES (1256, 'Clare County Animal Shelter', '4038 Hazel Road', 'Harrison', 'MI', '48625', '(989) 539-3221', 'http://www.clareco.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1257, 'Detroit Rescue Mission', '211 Glendale Street', 'Highland Park', 'MI', '48203', '(313) 869-8579', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1258, 'Copper Country Humane Society', '47375 Nara Park Road', 'Houghton', 'MI', '49931', '(906) 487-9560', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1259, 'Humane Society Of Livingston County', '2464 Dorr Road', 'Howell', 'MI', '48843', '(517) 552-8050', 'http://www.humane-livingston.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nLOST & FOUND SERVICE, FUNDED BY LOCAL DONATIONS\n'); INSERT INTO `default_table` VALUES (1260, 'Safe Haven Humane Society', '243 Lafayette Street', 'Ionia', 'MI', '48846', '(616) 522-1611', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1261, 'Hope Animal Shelter', '620 Easy Street', 'Ironwood', 'MI', '49938', '(906) 932-1511', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1262, 'Iron County Courthouse Complex-Crystal Falls Michigan', '1501 Mineral Avenue', 'Iron River', 'MI', '49935', '(906) 265-5366', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1263, 'Gratiot County - Animal Shelter', '2675 West Washington Road', 'Ithaca', 'MI', '48847', '(989) 875-2221', 'http://www.co.gratiot.mi.us', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1264, 'Kalamazoo Humane Society', '4239 South Westnedge Avenue', 'Kalamazoo', 'MI', '49008', '(269) 345-1181', 'http://www.kazoohumane.org', '', '', 'Mon-Fri/Weekdays', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nNon-Sheltering, Animal Info & Referrals, Spay / Neuter Assistance, Pet Food Assistance\n'); INSERT INTO `default_table` VALUES (1265, 'Animal Control-Kalamazoo County', '2500 Lake Street', 'Kalamazoo', 'MI', '49048', '(269) 383-8775', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1266, 'Capital Area Humane Society', '7095 West Grand River Avenue', 'Lansing', 'MI', '48906', '(517) 626-6060', 'http://www.cahs-lansing.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1267, 'Lapeer County - Animal Shelter', '2396 West Genesee Street', 'Lapeer', 'MI', '48446', '(810) 667-0236', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1268, 'Refuge Homoless Shelter', '534 Pine Street', 'Lapeer', 'MI', '48446', '(810) 245-1864', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1269, 'Animal Welfare Society of Southeastern Michigan', '29081 Dequindre Road', 'Madison Heights', 'MI', '48071', '(248) 548-1150', 'http://www.animalwelfaresociety.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1270, 'Critter Sitters', '590 Range Road', 'Marysville', 'MI', '48040', '(810) 364-2750', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1271, 'Michigan Wolf Dog Rescue', '590 Range Road', 'Marysville', 'MI', '48040', '(810) 364-2750', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1272, 'Animal Control & Shelter Ingham County', '600 Curtis Street', 'Mason', 'MI', '48854', '(517) 676-8370', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1273, 'Hide-Away Antiques & Sugar Bush', '9431 North M 37', 'Mesick', 'MI', '49668', '(231) 885-2900', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1274, 'Dairy Heir Kid''s Petting Zoo', '10691 County Line Road', 'Milan', 'MI', '48160', '(734) 439-7000', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1275, 'DHK Animal Rescue', '10691 County Line Road', 'Milan', 'MI', '48160', '(734) 439-7000', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1276, 'Humane Society Of Monroe', '111 East 1st Street', 'Monroe', 'MI', '48161', '(734) 240-0563', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1277, 'Humane Society of Monroe - Shelter', '833 North Telegraph Road', 'Monroe', 'MI', '48162', '(734) 243-3669', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1278, 'Animal Control Department', '1105 South Isabella Road', 'Mount Pleasant', 'MI', '48858', '(989) 773-9721', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1279, 'Dog Warden', '1105 South Isabella Road', 'Mount Pleasant', 'MI', '48858', '(989) 773-9721', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1280, 'Isabella County - Animal Control Department', '1105 South Isabella Road', 'Mount Pleasant', 'MI', '48858', '(989) 773-9721', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1281, 'Humane Animal Treatment Society', '1105 South Isabella Road', 'Mt Pleasant', 'MI', '48858', '(989) 775-0830', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1282, 'Webster House For Runaways', '1221 W Laketon Avenue', 'Muskegon', 'MI', '49441', '(231) 759-2520', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1283, 'Noah Project', '5205 Airline Highway', 'Muskegon', 'MI', '49444', '(231) 865-1264', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1284, 'Humane Society of Marquette County', '84 Snowfield Road', 'Negaunee', 'MI', '49866', '(906) 475-6661', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1285, 'Luce County - Animal Shelter', '13897 East Victory Way', 'Newberry', 'MI', '49868', '(906) 293-8377', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1286, 'K-9 Stray Rescue League', '2120 Metamora Road', 'Oxford', 'MI', '48371', '(248) 628-0435', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1287, 'Animal Control', '20701 Northland Drive', 'Paris', 'MI', '49338', '(231) 796-2221', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1288, 'Eve''s Groom & Room', '37792 Paw Paw Road', 'Paw Paw', 'MI', '49079', '(269) 657-3463', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1289, 'Schulze Duane N Dvm', '2277 North Gagetown Road', 'Pigeon', 'MI', '48755', '(989) 453-2335', '', '', '', 'Open 24 Hours/7 Days', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nYour Large & Small Animal Specialist, Pet & Stock Doctor, Veterinary Surgeon, Apothecary Expertise, Neutraceuticals, Consults, Pet Allergies, Unique Pet Supplies, Serving The Thumb For Over 35... (Show More)\nYour Large & Small Animal Specialist, Pet & Stock Doctor, Veterinary Surgeon, Apothecary Expertise, Neutraceuticals, Consults, Pet Allergies, Unique Pet Supplies, Serving The Thumb For Over 35 Years, We Make House Calls  (Show Less)\n'); INSERT INTO `default_table` VALUES (1290, 'Michigan Animal Rescue League Inc', '790 Featherstone Street', 'Pontiac', 'MI', '48342', '(248) 335-9290', 'http://www.michigananimalrescueleague.org', 'info@michigananimalrescueleague.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1291, 'SPCA', '6266 Lapeer N Road Street', 'Port Huron', 'MI', '48060', '(810) 987-4357', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1292, 'Eaton County Humane Society', '208 East Main Street', 'Potterville', 'MI', '48876', '(517) 645-2000', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1293, 'Branch County Government - Animal Control Department', '180 South Ray', 'Quincy', 'MI', '49082', '(517) 639-3210', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1294, 'Animal Shelter-Sunrise Rotary', '168 South Ray Quincy Road', 'Quincy', 'MI', '49082', '(517) 639-3210', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1295, 'SPCA of Southwest Michigan', '10788 M 43', 'Richland', 'MI', '49083', '(269) 629-0567', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1296, 'Michigan Humane Society Shelter', '3600 West Auburn Road', 'Rochester Hills', 'MI', '48309', '(248) 852-7420', 'http://www.michiganhumane.org', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Additional Information:
\nSomebody Here Needs You, Full Service Veterinary Medical Centers, Please Help Stop Companion Animal, Overpopulation, Spay Or Neuter\n'); INSERT INTO `default_table` VALUES (1297, 'Safe', '621 S Fayette Street', 'Saginaw', 'MI', '48602', '(989) 921-8054', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1298, 'Ark Association To Rescue Kritters', '3878 South Maple Valley Road', 'Saint Helen', 'MI', '48656', '(989) 389-3305', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1299, 'Mackinac County Animal Shelter', '980 Cheeseman Road', 'Saint Ignace', 'MI', '49781', '(906) 643-7646', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1300, 'Sanilac County - Animal Control Department', '35 South Stoutenburg Road', 'Sandusky', 'MI', '48471', '(810) 648-4831', 'http://www.sanilacpets.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1301, 'Chippewa County Animal Control Shelter', '3660 South Mackinac Trail', 'Sault Sainte Marie', 'MI', '49783', '(906) 632-2519', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1302, 'Humane Society of Macomb', '11350 22 Mile Road', 'Shelby Township', 'MI', '48317', '(586) 731-9210', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1303, 'Montcalm County - Animal Shelter', '155 Quarterline', 'Stanton', 'MI', '48888', '(616) 225-7355', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1304, 'Animal Shelter', '155 Quarterline', 'Stanton', 'MI', '48888', '(989) 831-7355', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1305, 'Animal Shelter', '25555 Northline Road', 'Taylor', 'MI', '48180', '(734) 946-4105', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters, Pet Shops\n'); INSERT INTO `default_table` VALUES (1306, 'National Homeless Associations', '14646 Fellrath Street', 'Taylor', 'MI', '48180', '(734) 947-6380', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1307, 'Silver Lake Animal Rescue League', '2850 Dixie Highway', 'Waterford', 'MI', '48328', '(248) 545-6583', 'http://www.silverlake.petfinder.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1308, 'Michigan Humane Society Shelter', '900 North Newburgh Road', 'Westland', 'MI', '48185', '(734) 721-7300', 'http://www.michiganhumane.org', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1309, 'Ogemaw County Humane Society', '381 White Ridge Trail', 'West Branch', 'MI', '48661', '(989) 343-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1310, 'Downtown Antiques & Collectibles', '318 West Houghton Avenue', 'West Branch', 'MI', '48661', '(989) 343-1391', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1311, 'Harbor Humane Society', '14345 Bagley Street', 'West Olive', 'MI', '49460', '(616) 399-2119', 'http://www.harborhumane.org', '', '', 'Open Monday-Saturday', '\nPayment Options:
\n\n'); INSERT INTO `default_table` VALUES (1312, 'Newaygo County - Animal Shelter', '78 North Webster Street', 'White Cloud', 'MI', '49349', '(231) 689-1867', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1313, 'Lakes Area Humane Society', '3811 Nevada Street Southwest', 'Alexandria', 'MN', '56308', '(320) 759-2260', 'http://lahs.petfinder.com', '', '', '6 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLost & Found Pets, Quality Pets For Adoption, Neutered & Spayed, Dogs - Cats - Exotics\n'); INSERT INTO `default_table` VALUES (1314, 'Crossroads Animal Shelter', '2800 10th Street Southeast', 'Buffalo', 'MN', '55313', '(763) 684-1234', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1315, 'Humane Society Of Wright County', '4375 State Highway 55 Southeast', 'Buffalo', 'MN', '55313', '(763) 682-7061', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1316, 'Animal Shelter', '2627 Courtland Street', 'Duluth', 'MN', '55806', '(218) 723-3259', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1317, 'Rice County Humane Society', '1201 Cannon Circle', 'Faribault', 'MN', '55021', '(507) 334-7117', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1318, 'Last Hope Inc', '19161 Echo Lane', 'Farmington', 'MN', '55024', '(651) 463-8747', 'http://www.last-hope.org', 'angela@last-hope.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1319, 'Northwoods Humane Society', '7153 Lake Boulevard', 'Forest Lake', 'MN', '55025', '(651) 982-0240', 'http://www.northwoodshs.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1320, 'Millers Animal Control', '38 RR 2', 'Glenville', 'MN', '56036', '(507) 377-7204', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1321, 'Animal Ark', '2600 Industrial Court', 'Hastings', 'MN', '55033', '(651) 438-2195', 'http://www.animalarkshelter.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1322, 'Heart Of Minnesota Animal Shelter', '880 Century Avenue Southwest', 'Hutchinson', 'MN', '55350', '(320) 234-9699', 'http://www.heartofminnesota.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1323, 'Alliance Housing Limited Partnership', '719 E 16th Street', 'Minneapolis', 'MN', '55404', '(612) 630-3600', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1324, 'St Stephens Shelter', '2211 Clinton Avenue', 'Minneapolis', 'MN', '55404', '(612) 871-9711', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1325, 'Gentle Touch Animal Sanctuary', '4900 France Avenue North', 'Minneapolis', 'MN', '55429', '(763) 537-5599', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1326, 'Almost Home Animal Shelter', '2283 Highway 23', 'Mora', 'MN', '55051', '(320) 679-5376', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1327, 'Top Dog Foundation Inc', '5120 Vega Avenue', 'New Germany', 'MN', '55367', '(952) 353-2122', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1328, 'Pups Facility', '11350 89th Avenue North', 'Osseo', 'MN', '55369', '(763) 424-5257', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1329, 'Headwaters Animal Shelter', '901 Western Avenue South', 'Park Rapids', 'MN', '56470', '(218) 237-7100', 'http://www.headwatersanimalshelter.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1330, 'Humane Society', '967 Western Avenue South', 'Park Rapids', 'MN', '56470', '(218) 237-7100', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1331, 'Vic Fiberglass Calf Hutches', '17003 County Road 181', 'Paynesville', 'MN', '56362', '(320) 243-7234', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1332, 'Paws & Claws Humane Society', '602 7th Street Northwest', 'Rochester', 'MN', '55901', '(507) 288-7226', 'http://www.pawsandclaws.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1333, 'Safe Haven Pet Rescue', '1001 1/2 Southeast Avenue', 'Rochester', 'MN', '55901', '(507) 529-4079', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1334, 'Westwind Acres', '4300 42nd Street Southwest', 'Rochester', 'MN', '55902', '(507) 282-5732', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1335, 'Moline Gunny', '4300 42nd Street Southwest', 'Rochester', 'MN', '55902', '(507) 282-5732', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1336, 'Caring for Cats', '2141 Division Street North', 'Saint Paul', 'MN', '55109', '(651) 407-8485', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1337, 'Animal Control Services Inc', '1283 Hammond Road', 'Saint Paul', 'MN', '55110', '(651) 653-6404', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1338, 'American Pest Solutions', '6300 Rolling Hills Drive', 'Saint Paul', 'MN', '55110', '(651) 429-1531', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nPest and Wildlife Solutions, Specializing in the removal of:, Carpenter Ants Spiders Bees Bats Ants Centipedes Birds Mice Squirrels Moles Wasps Boxelder Bugs Asian Beetles and More, Guaranteed Results\n'); INSERT INTO `default_table` VALUES (1339, 'Feline Rescue', '593 Fairview North', 'Saint Paul', 'MN', '55104', '(651) 642-5900', 'http://www.felinerescue.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1340, 'Humane Society For Companion Animals - Located One Block West Of Como & Lexington', '1115 Beulah Lane', 'Saint Paul', 'MN', '55108', '(651) 645-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1341, 'Larpenteur Animal Hospital', '1136 Larpenteur Avenue West', 'Saint Paul', 'MN', '55113', '(651) 487-3712', '', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n
Additional Information:
\nSee Individual Member Listings For Further Information\n'); INSERT INTO `default_table` VALUES (1342, 'Animal Ark''s Thrift Store', '809 7th Street East', 'Saint Paul', 'MN', '55106', '(651) 772-8983', 'http://www.animalarkshelter.org', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nBenefits Homeless Animals, See Our Ad Under Animal Shelters & Humane Societies\n'); INSERT INTO `default_table` VALUES (1343, 'Norgaard Family Hog Farm', '2867 170th Street', 'Tyler', 'MN', '56178', '(507) 247-3525', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1344, 'Rankin County - Animal Shelter', '710 Marquette Road', 'Brandon', 'MS', '39042', '(601) 824-2024', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1345, 'Cedar Hill Animal Sanctuary', '84 Sanctuary Loop', 'Caledonia', 'MS', '39740', '(662) 356-6636', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1346, 'Animal Shelter Clarksdale-Coahoma County', '310 Anderson Boulevard', 'Clarksdale', 'MS', '38614', '(662) 627-6844', '', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt A Vaccinated Dog Or Cat\n'); INSERT INTO `default_table` VALUES (1347, 'Humane Society of Leflore County', '601 Ione Street', 'Greenwood', 'MS', '38930', '(662) 453-8085', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1348, 'Southern Pines Animal Shelter', '1901 North 31st Avenue', 'Hattiesburg', 'MS', '39401', '(601) 544-6632', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1349, 'Animal Shelter Southern Pines', '1901 North 31st', 'Hattiesburg', 'MS', '39401', '(601) 554-8987', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1350, 'Southaven Animal Shelter', '3086 Stateline Road West', 'Horn Lake', 'MS', '38637', '(662) 393-0511', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1351, 'Southaven Animal Shelter', '5813 Pepper Chase Drive', 'Horn Lake', 'MS', '38637', '(662) 796-2490', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1352, 'Southaven City - Public Works Department, Animal Control', '5813 Pepper Chase Drive', 'Horn Lake', 'MS', '38637', '(662) 796-2491', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1353, 'Mississippi Animal Rescue League', '4395 Thomas Catchings Sr', 'Jackson', 'MS', '39201', '(601) 969-1631', 'http://www.msarl.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDogs Puppies Kittens & Cats For Adoption, Come Find A Friend & Save A Life\n'); INSERT INTO `default_table` VALUES (1354, 'Community Animal Rescue & Adoption', '960 North Flag Chapel Road', 'Jackson', 'MS', '39209', '(601) 922-7575', 'http://www.cara.petfinder.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLet Us Help Spay Or Neuter Your Pets\n'); INSERT INTO `default_table` VALUES (1355, 'Animal Rescue League', '2511 Moose Drive', 'Laurel', 'MS', '39440', '(601) 649-0821', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1356, 'Lucedale City Of Animal Shelter', '243 Beaver Dam Road', 'Lucedale', 'MS', '39452', '(601) 947-7994', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1357, 'McComb Animal Shelter', '125 East Michigan Avenue', 'Mccomb', 'MS', '39648', '(601) 684-3602', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1358, 'Lawrence County Animal Rescue Bargain Store', '141 Jefferson Street North', 'Monticello', 'MS', '39654', '(601) 587-0905', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1359, 'Humane Society Oxford-Lafayette', '559 Highway 7 South', 'Oxford', 'MS', '38655', '(662) 236-7631', 'http://www.oxfordpets.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1360, 'Oxford Lafayette Humane Society', '599 South Highway 7', 'Oxford', 'MS', '38655', '(662) 281-8888', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1361, 'Animal Shelter Of Picayune', '1700 Palestine Road', 'Picayune', 'MS', '39466', '(601) 798-8000', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1362, 'Southaven Animal Shelter', '5813 Pepper Chase Drive', 'Southaven', 'MS', '38671', '(662) 796-2491', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1363, 'Starkville City - Police Department, Animal Control', '111 North Washington Street', 'Starkville', 'MS', '39759', '(662) 324-1556', '', '', '', 'Mon-Fri/Weekdays', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1364, 'Vicksburg City - Animal Shelter', '100 Old Mill Road', 'Vicksburg', 'MS', '39180', '(601) 636-6982', 'http://www.vicksburg.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1365, 'Southaven City Of Animal Control', '5813 Pepper Chase Drive', 'Walls', 'MS', '38680', '(662) 796-2491', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1366, 'Mains Bird & Animal Farm', '314 RR 1', 'Amoret', 'MO', '64722', '(660) 925-3311', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1367, 'Missouri Wildlife Rescue Center', '1128 New Ballwin Road', 'Ballwin', 'MO', '63021', '(636) 394-4546', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1368, 'Blue Chip Exterminating', '15537 Manchester Road', 'Ballwin', 'MO', '63011', '(636) 394-9500', 'http://www.bluechipexterminating.com', '', '', 'Open Saturdays', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nNuisance Wildlife Control\n'); INSERT INTO `default_table` VALUES (1369, 'Second Chance Saloon', '205 South 16th', 'Bethany', 'MO', '64424', '(660) 425-9907', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nYour Horse Deserves The Very Best, Outdoor Arena, Matted Stalls, Lessons\n'); INSERT INTO `default_table` VALUES (1370, 'Humane Society of Southeast Missouri', '2536 Boutin Drive', 'Cape Girardeau', 'MO', '63701', '(573) 334-5837', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1371, 'Adopt & Shop', '146 Chesterfield Mall', 'Chesterfield', 'MO', '63017', '(636) 530-0805', 'http://www.hsmo.org', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (1372, 'Clinton City - City Offices, Animal Shelter', '1307 North Washington Street', 'Clinton', 'MO', '64735', '(660) 885-7999', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1373, 'Blue Chip', '1623 Headland Drive', 'Fenton', 'MO', '63026', '(636) 394-9500', 'http://www.bluechipexterminating.com', '', '', '', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nYou Have Questions We Have Answers, You Have Problems We Have Solutions, Family Owned & Operated For 35 Years, Professional Pest Management, Custom Designed Programs For Homes & Business, Termite... (Show More)\nYou Have Questions We Have Answers, You Have Problems We Have Solutions, Family Owned & Operated For 35 Years, Professional Pest Management, Custom Designed Programs For Homes & Business, Termite Control, Wildlife Control, Certified Uniformed & Security Screened Techs, Odorless Products, Flexible S  (Show Less)\n'); INSERT INTO `default_table` VALUES (1374, 'Animal Shelter', '4100 7 Hills Drive', 'Florissant', 'MO', '63033', '(314) 831-6500', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1375, 'St Louis-County Of Health-Dept Of', '4100 7 Hills Drive', 'Florissant', 'MO', '63033', '(314) 831-6500', '', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (1376, 'Fulton City - Animal Control Shelter', '611 East 8th Street', 'Fulton', 'MO', '65251', '(573) 642-7443', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1377, 'CritterConnection', '6817 Stony Point Road', 'Grain Valley', 'MO', '64029', '(816) 847-8722', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1378, 'Northeast Missouri Humane Scty', '107 S Main Street', 'Hannibal', 'MO', '63401', '(573) 248-2042', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1379, 'Taney County Animal Control', '128 Dundee Road', 'Hollister', 'MO', '65672', '(417) 332-0172', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1380, 'Callaway Hills Animal Shelter', '2714 State Road Tt', 'Holts Summit', 'MO', '65043', '(573) 896-4049', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1381, 'Open Door Animal Sanctuary', '6065 Duda Road', 'House Springs', 'MO', '63051', '(636) 671-3643', 'http://www.odas.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1382, 'Safe Harbor Animal Sanctuary', '359 Cree Lane', 'Jackson', 'MO', '63755', '(573) 243-9823', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1383, 'Jefferson City Animal Shelter', '919 East Miller Street', 'Jefferson City', 'MO', '65101', '(573) 634-6429', 'http://www.jeffcitymo.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1384, 'Cool Valley Kennels', '26 Hayfield Lane', 'Jonesburg', 'MO', '63351', '(636) 488-5901', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nReasonable Rates, Individual Care\n'); INSERT INTO `default_table` VALUES (1385, 'Country Kennels', '10014 East 47th Street', 'Kansas City', 'MO', '64133', '(816) 353-5675', 'http://www.ckpets.net', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Adoptions - Cats Dogs Puppies Kittens, Adoption Free Includes Spay Or Neuter, 1st Round Vaccinations Exam Microchip\n'); INSERT INTO `default_table` VALUES (1386, 'Spay Neuter Services Of Kansas City', '10014 East 47th Street', 'Kansas City', 'MO', '64133', '(816) 353-5675', 'http://www.ckpets.net', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Additional Information:
\n29.00\n'); INSERT INTO `default_table` VALUES (1387, 'Gladstone Animal Shelter', '3960 Northeast 76th Street', 'Kansas City', 'MO', '64116', '(816) 436-1810', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nHappiness Is A Pet Adopted From, Spray Or Neuter, Prevent Unwanted Litters, Be A Responsible Pet Owner\n'); INSERT INTO `default_table` VALUES (1388, 'Animal Medical Center', '204 West 75th Street', 'Kansas City', 'MO', '64114', '(816) 333-9000', 'http://www.animalmedicalcenterkc.com', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nComplete Veterinary Care, Early Morning Drop Off, Lunch Appointments, Annual Health Plan, 1/2 Price Spay/Neuter/Dental Day\n'); INSERT INTO `default_table` VALUES (1389, 'Wayside Waifs Inc', '3901 Martha Truman Road', 'Kansas City', 'MO', '64137', '(816) 761-8151', 'http://www.waysidewaifs.org', '', '', 'Open 6 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSee Ads At Humane Societies And Pet Cemeteries\n'); INSERT INTO `default_table` VALUES (1390, 'Friendsof Parkville Animal Shelter', '1356 North State Route 9', 'Kansas City', 'MO', '64152', '(816) 587-0918', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1391, 'Home On The Range Animal Sanctuary', '5635 NW Union Chapel Road', 'Kansas City', 'MO', '64152', '(816) 801-7030', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1392, 'Humane Society', '22376 State Highway 6', 'Kirksville', 'MO', '63501', '(660) 665-8038', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1393, 'Animal Health Center', '63 Highway', 'Lancaster', 'MO', '63548', '(660) 457-3086', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1394, 'Foster James J Dvm', '63 Highway', 'Lancaster', 'MO', '63548', '(660) 457-3086', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1395, 'Liberty Animal Shelter', '1501 East Old 210 Highway', 'Liberty', 'MO', '64068', '(816) 415-1877', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Additional Information:
\nThe City Of Liberty, Spay Or Neuter, Prevent Unwanted Litters, Be A Responsible Pet Owner\n'); INSERT INTO `default_table` VALUES (1396, 'Marshall Animal Shelter', '325 North Grant Avenue', 'Marshall', 'MO', '65340', '(660) 831-0420', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1397, 'We Care Animal Rescue', '1000 West Washington Street', 'Marshfield', 'MO', '65706', '(417) 859-2456', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1398, 'Humane Society Of Missoury', '2400 Drilling Service Drive', 'Maryland Heights', 'MO', '63043', '(314) 739-9982', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1399, 'Nodaway Animal Shelter', '829 South Depot Street', 'Maryville', 'MO', '64468', '(660) 562-3333', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1400, 'Mexico City - Animal Shelter', '101 South Morris Street', 'Mexico', 'MO', '65265', '(573) 581-0779', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1401, 'Dogwood Animal Shelter', '1075 Runabout Drive', 'Osage Beach', 'MO', '65065', '(573) 348-4411', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nNeed A Place To Party, Dogwood Banquet Facilities, New, Non Smoking Facility, Wedding Receptions, Land Mark Birthday Gatherings, Graduation Celebrations - Reunions, Anniversary Celebrations - Full... (Show More)\nNeed A Place To Party, Dogwood Banquet Facilities, New, Non Smoking Facility, Wedding Receptions, Land Mark Birthday Gatherings, Graduation Celebrations - Reunions, Anniversary Celebrations - Full Kitchen, Chairs & Tables Provided, All Proceeds Benefit Dogwood Animal Shelter, Great Location  (Show Less)\n'); INSERT INTO `default_table` VALUES (1402, 'Second Chance', '16390 Harris Road', 'Prairie Home', 'MO', '65068', '(660) 841-5565', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nYour Horse Deserves The Very Best, Outdoor Arena, Matted Stalls, Lessons\n'); INSERT INTO `default_table` VALUES (1403, 'City Of Richmond Animal Shelter', '9073 Wellington Street', 'Richmond', 'MO', '64085', '(816) 776-6466', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1404, 'Rolla Animal Control', '1915 Sharp Road', 'Rolla', 'MO', '65401', '(573) 364-6995', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1405, 'Animal Control', '1855 Happy Sac Road', 'Saint Clair', 'MO', '63077', '(636) 629-1273', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1406, 'Animal Shelter', '701 Lower Lake Road', 'Saint Joseph', 'MO', '64504', '(816) 271-4876', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1407, 'Humane Society of Missouri', '1201 Macklind Avenue', 'Saint Louis', 'MO', '63110', '(314) 951-1534', 'http://www.hsmo.org', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nCaring Is Our Specialty, Veterinary Medical Centers, Wellness Exams, Spay / Neuter / Declaw, Microchipping, Your Patronage Helps Us To Rescue Provide Care And Find Homes Or Homeless Pets\n'); INSERT INTO `default_table` VALUES (1408, 'Humane Society of Missouri', '1201 Macklind Avenue', 'Saint Louis', 'MO', '63110', '(314) 951-1562', 'http://www.hsmo.org', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nComplete Cremation Services\n'); INSERT INTO `default_table` VALUES (1409, 'Humane Society of Missouri', '1201 Macklind Avenue', 'Saint Louis', 'MO', '63110', '(314) 802-5709', 'http://www.hsmo.org', '', '', 'After Hours', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nMember Assn Pet Dog Trainers, Complete Dog Training, Private Lessons Available\n'); INSERT INTO `default_table` VALUES (1410, 'Humane Society of Missouri', '1201 Macklind Avenue', 'Saint Louis', 'MO', '63110', '(314) 951-1540', 'http://www.hsmo.org', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nMember Assn Pet Dog Trainers, Complete Dog Training, Private Lessons Available\n'); INSERT INTO `default_table` VALUES (1411, 'Humane Society of Missouri', '1201 Macklind Avenue', 'Saint Louis', 'MO', '63110', '(314) 951-1566', 'http://www.petshoppingspree.orgwww.hsmo.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Motif Gifts & Supplies, Adopt & Shop Stores, M-S 10-9:30, Sun 11-6, Shop Online wwwpetshoppingspreeorg\n'); INSERT INTO `default_table` VALUES (1412, 'Wild Bird Rehabilitation', '9624 Midland Boulevard', 'Saint Louis', 'MO', '63114', '(314) 447-0060', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Protection Organizations\n'); INSERT INTO `default_table` VALUES (1413, 'Clowder House Foundation', '3134 Wyoming Street', 'Saint Louis', 'MO', '63118', '(314) 776-7877', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1414, 'St Louis-City - Health & Hospitals Department, Health Services, Animal Regulation Center-Dog Pound', '2120 Gasconade Street', 'Saint Louis', 'MO', '63118', '(314) 353-5838', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1415, 'Abc Animal & Insect Innovations LLC', '8336 Vasel Drive', 'Saint Louis', 'MO', '63123', '(314) 752-2221', '', '', '', '', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nYellow Jackets, Hornets, Carpenter Bees, Honey Bees, Bumble Bees, Wasps\n'); INSERT INTO `default_table` VALUES (1416, 'Apa Of Missouri', '1705 South Hanley Road', 'Saint Louis', 'MO', '63144', '(314) 645-4610', 'http://www.apamo.org', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nBringing People And Pets Together Since 1922, Friends For Life, Adoptions & Shelter, Dogs Cats Puppies & Kittens-Let Us Find The Perfect Match For You, Veterinary Clinic Mon-Fri 10-4 Sat 10-1\n'); INSERT INTO `default_table` VALUES (1417, 'A Pa', '1705 South Hanley Road', 'Saint Louis', 'MO', '63144', '(314) 645-4610', 'http://www.apamo.org', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Additional Information:
\nBringing People And Pets Together Since 1922, Friends For Life, Adoptions & Shelter, Dogs Cats Puppies & Kittens-Let Us Find The Perfect Match For You, Veterinary Clinic Mon-Fri 9-4 Sat 9-4\n'); INSERT INTO `default_table` VALUES (1418, 'Animal House Fund', '301 S Van Buren Avenue', 'Saint Louis', 'MO', '63122', '(314) 909-4167', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1419, 'St Louis Animal Rights Team', '12520 Olive Boulevard', 'Saint Louis', 'MO', '63141', '(314) 851-0928', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1420, 'Adopt A Stray', '1600 Mid Rivers Mall', 'Saint Peters', 'MO', '63376', '(636) 397-0040', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1421, 'St Peters City - Business Numbers, Animal Shelter', '4850 Mid Rivers Mall Drive', 'Saint Peters', 'MO', '63376', '(636) 949-7354', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1422, 'Sedalia-City - Animal Shelter', '2900 West Main Street', 'Sedalia', 'MO', '65301', '(660) 826-5816', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1423, 'Humane Society', '2900 West Main Street', 'Sedalia', 'MO', '65301', '(660) 826-5816', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1424, 'Mid-Missouri Humane Society Animal Shelter', '2900 W Main Street', 'Sedalia', 'MO', '65301', '(660) 827-3000', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1425, 'Springfield-City - Health Department, Animal Shelter', '4002 North Farmer', 'Springfield', 'MO', '65802', '(417) 833-3592', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1426, 'Southwest Missouri Humane Society Inc', '3161 West Norton Road', 'Springfield', 'MO', '65803', '(417) 833-2526', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1427, 'Animal Orphanage Inc', '18081 Highway West', 'Versailles', 'MO', '65084', '(573) 378-2275', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1428, 'Warrensburg Animal Shelter', '35 Southeast 101 Road', 'Warrensburg', 'MO', '64093', '(660) 747-7156', 'http://www.warrensburg-mo.com', '', '', 'Tuesday-Thursday-Friday 12:00Pm-5:00Pm,wednesday 12:00Pm-6:00Pm,saturday 11:00Am-2:00Pm,closed Sunda', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLarge Selection Of Dogs And Cats\n'); INSERT INTO `default_table` VALUES (1429, 'Nelson Rolf Animal Shelter', '1215 Medic Street', 'Warsaw', 'MO', '65355', '(660) 438-8880', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Additional Information:
\nCremation Service Available\n'); INSERT INTO `default_table` VALUES (1430, 'Animal Control Department', '1005 Bratton Avenue', 'West Plains', 'MO', '65775', '(417) 255-1860', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1431, 'West Plains City Of', '1005 Bratton Avenue', 'West Plains', 'MO', '65775', '(417) 255-1860', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1432, 'Humane Society of the United States', '490 North 31st Street', 'Billings', 'MT', '59101', '(406) 255-7161', 'http://www.hsus.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1433, 'Animal Shelter - Lost Pet Hotline', '302 Edwards Street', 'Billings', 'MT', '59101', '(406) 657-8213', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1434, 'Animal Shelter', '1735 Monad Road', 'Billings', 'MT', '59101', '(406) 657-8226', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1435, 'Heart Of The Valley Animel Shelter Operations', '2125 North Rouse Avenue', 'Bozeman', 'MT', '59715', '(406) 582-1847', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1436, 'Butte Animal Shelter', '699 Centennial Avenue', 'Butte', 'MT', '59701', '(406) 782-8450', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1437, 'Dedman Foundation', '2400 High', 'Fort Benton', 'MT', '59442', '(406) 622-5657', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1438, 'Animal Shelter', '262 Fairgrounds Road', 'Hamilton', 'MT', '59840', '(406) 363-5311', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1439, 'Bitter Root Humane Associates', '262 Fairgrounds Road', 'Hamilton', 'MT', '59840', '(406) 363-5311', 'http://www.bitterroothumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1440, 'Havre City - Animal Shelter', '520 4th Street', 'Havre', 'MT', '59501', '(406) 265-2959', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1441, 'Staford Animal Shelter Society Of Park County', '3 Business Park Drive', 'Livingston', 'MT', '59047', '(406) 222-2111', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1442, 'Humane Society of Western Montana', '5930 US Highway 93 South', 'Missoula', 'MT', '59804', '(406) 549-3934', 'http://www.missoulahumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1443, 'Humane Society Animal Shelter', '1105 Clark Fork Drive', 'Missoula', 'MT', '59808', '(406) 549-3934', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1444, 'Hearts United for Animals', '73420 638 Avenue', 'Auburn', 'NE', '68305', '(402) 274-3679', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1445, 'Beatrice Animal Shelter', '400 Ella Street', 'Beatrice', 'NE', '68310', '(402) 228-9100', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1446, 'Beatrice Humane Society', '400 Ella Street', 'Beatrice', 'NE', '68310', '(402) 228-9100', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1447, 'Animal Control', '341 Grant Street', 'Blair', 'NE', '68008', '(402) 533-2743', '', '', '', 'Monday-Friday 8:00Am-5:00Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1448, 'Columbus Animal Shelter', '2709 5th Street', 'Columbus', 'NE', '68601', '(402) 564-8839', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1449, 'Platte Valley Humane Society', '17162 280th Street', 'Columbus', 'NE', '68601', '(402) 564-5015', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1450, 'Lextron Animal Health', '3388 10th Street', 'Gering', 'NE', '69341', '(308) 635-3861', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1451, 'LA Vista City Offices - Police Department, Animal Control', '7701 South 96th Street', 'La Vista', 'NE', '68128', '(402) 444-7800', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1452, 'Capital Humane Society', '2320 Park Boulevard', 'Lincoln', 'NE', '68502', '(402) 441-4488', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Care Materials For All Animals, For Owner''s Animals, Tours Of Shelter & Educational Presentations, Pet Adoption, Volunteer Program\n'); INSERT INTO `default_table` VALUES (1453, 'Norfolk Dog Pound', '2800 West Eisenhower Avenue', 'Norfolk', 'NE', '68701', '(402) 379-0511', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1454, 'Puppy Love', '2800 West Eisenhower Avenue', 'Norfolk', 'NE', '68701', '(402) 379-0511', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDOG GROOMING AT ITS FINEST, ALL BREEDS - LARGE & SMALL, ALSO - NORFOLK CITY DOG POUND\n'); INSERT INTO `default_table` VALUES (1455, 'North Platte City - Animal Shelter', '1402 North Sycamore Street', 'North Platte', 'NE', '69101', '(308) 535-6780', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1456, 'Bone JOUR Dog Daycare', '8801 Fort Street', 'Omaha', 'NE', '68134', '(402) 444-7800', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1457, 'Nebraska Humane Society', '8929 Fort Street', 'Omaha', 'NE', '68134', '(402) 444-7800', 'http://www.nehumanesociety.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nJust This Side Of Heaven Is A Place Called The Rainbow Bridge, The Nebraska Humane Society Is Proud To Offer The Finest In Private Cremation Services For Your Pet Now You And Your Family Can Rest... (Show More)\nJust This Side Of Heaven Is A Place Called The Rainbow Bridge, The Nebraska Humane Society Is Proud To Offer The Finest In Private Cremation Services For Your Pet Now You And Your Family Can Rest Assured Knowing That Your Beloved Friend Will Be Treated With Utmost Dignity And Respect, A Service Provided By The Nebraska Humane Society  (Show Less)\n'); INSERT INTO `default_table` VALUES (1458, 'Rainbow Bridge', '8929 Fort Street', 'Omaha', 'NE', '68134', '(402) 444-7800', 'http://www.nehumanesociety.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nJust this side of heaven is a place called the Rainbow Bridge, The Nebraska Humane Society is proud to offer the finest in private cremation services for your pet Now you and your family can rest... (Show More)\nJust this side of heaven is a place called the Rainbow Bridge, The Nebraska Humane Society is proud to offer the finest in private cremation services for your pet Now you and your family can rest assured knowing that your beloved friend will be treated with utmost dignity and respect, A service provided by the Nebras  (Show Less)\n'); INSERT INTO `default_table` VALUES (1459, 'Steamfitters Local 464 Welfare Fund', '10801 Pacific Street', 'Omaha', 'NE', '68154', '(402) 341-8771', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1460, 'Life Line Adoption', '16909 Lakeside Hills Plaza Suite 104', 'Omaha', 'NE', '68130', '(402) 614-5657', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nSpecializing In Placing Older And Special Need Cats, Special Assistance For Cats Adopted By Seniors Call For Info\n'); INSERT INTO `default_table` VALUES (1461, 'Churchill Animal Protection Society', '5894 Pasture Road', 'Fallon', 'NV', '89406', '(775) 423-7500', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1462, 'Lied Animal Shelter', '655 North Mojave Road', 'Las Vegas', 'NV', '89101', '(702) 384-3333', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt A Friend Save A Life\n'); INSERT INTO `default_table` VALUES (1463, 'Animal Foundation', '655 N Mojave Road', 'Las Vegas', 'NV', '89101', '(702) 384-3333', '', '', '', 'Adoptions Open 7 Days 11:00Am To 6:00Pm', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (1464, 'Nevada Spca-No Kill Animal Sanctuary', '4800 West Dewey Drive', 'Las Vegas', 'NV', '89118', '(702) 873-7722', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1465, 'West Star Ranch', '780 Manse Road Frnt', 'Pahrump', 'NV', '89048', '(775) 727-9273', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1466, 'Nye County - Animal Shelter', '1520 East Basin Avenue', 'Pahrump', 'NV', '89060', '(775) 751-7020', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1467, 'Miracle Horse Rescue Inc', '2220 West Simkins Road', 'Pahrump', 'NV', '89060', '(775) 751-1101', 'http://www.miraclehorse.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1468, 'A New Leash On Life', '6151 Quarter Horse Avenue', 'Pahrump', 'NV', '89061', '(775) 537-2020', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1469, 'Nevada Humane Society', '2825 Longley Lane', 'Reno', 'NV', '89502', '(775) 283-5463', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1470, 'Spca Of Northern Nevada - Adoption Center, Low-Cost Spay & Neuter Clinic', '840 East 5th Street', 'Reno', 'NV', '89512', '(775) 324-7773', 'http://www.spcaofnn.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1471, 'Lyon County - Animal Shelter', '3705 US Highway 50', 'Silver Springs', 'NV', '89429', '(775) 577-5005', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1472, 'Nevada Humane Society', '200 Kresge Lane', 'Sparks', 'NV', '89431', '(775) 331-5770', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1473, 'Nye County Of (court House) - Animal Control', '101 Radar Road', 'Tonopah', 'NV', '89049', '(775) 482-8101', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1474, 'Foccas', '7595 West Rose Creek Road', 'Winnemucca', 'NV', '89445', '(775) 625-4356', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1475, 'Friends of Castaway Companions Animal Shelter', '7595 West Rose Creek Road', 'Winnemucca', 'NV', '89445', '(775) 625-4356', 'http://www.foccas.petfinder.com', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nA New Friend Is Waiting For You Adopt From FOCCAS And Save A Life, Our Dogs Are, Alternated Vaccinated & Microchipped, Plus 30 Days Pet Insurance Coverage, Our Website Is Updated With The Latest In... (Show More)\nA New Friend Is Waiting For You Adopt From FOCCAS And Save A Life, Our Dogs Are, Alternated Vaccinated & Microchipped, Plus 30 Days Pet Insurance Coverage, Our Website Is Updated With The Latest In Fine Friends, Donations Gratefully Accepted  (Show Less)\n'); INSERT INTO `default_table` VALUES (1476, 'Animal Rescue Foundation', '28 US Highway 95A North', 'Yerington', 'NV', '89447', '(775) 463-1818', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1477, 'Animal Rescue League of NH', '545 Route 101', 'Bedford', 'NH', '03110', '(603) 472-3647', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1478, 'Spay Neuter Assistance Programs', '24 Montgomery Street', 'Concord', 'NH', '03301', '(603) 228-6755', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1479, 'Pet Net Referral System', '24 Montgomery Street', 'Concord', 'NH', '03301', '(603) 228-6755', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1480, 'Conway Area Humane Society', '223 East Main Street', 'Conway', 'NH', '03818', '(603) 447-5955', 'http://www.conwayshelter.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1481, 'Animal Shelter-Cocheco Valley Humane Society', '262 County Farm Road', 'Dover', 'NH', '03820', '(603) 749-5322', 'http://www.cvhsonline.org', '', 'When Considering A Pet... Consider A Homeless Animal', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\n``When Considering A Pet..., Consider A Homeless Animal'''', 6 Dogs 6 Cats 6 Hamsters 6 Gerbils 6, Birds 6 Livestock (When Available)\n'); INSERT INTO `default_table` VALUES (1482, 'Laurel Heights Stables', '39 Laurel Heights', 'Fitzwilliam', 'NH', '03447', '(603) 585-9995', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1483, 'Granite State Animal League', '71 Punch Brook Road', 'Franklin', 'NH', '03235', '(603) 934-4132', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1484, 'Seacoast Area Feline Education and Rescue', '663 Exeter Road', 'Hampton', 'NH', '03842', '(603) 929-4975', 'http://www.felinerescue.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1485, 'Kitty Rescue and Adoption', '11 Plantation Drive', 'Jaffrey', 'NH', '03452', '(603) 532-9444', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1486, 'New Hampshire Humane Society', '1305 Meredith Center Road', 'Laconia', 'NH', '03246', '(603) 273-0099', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1487, 'Manchester Animal Shelter', '490 Dunbarton Road', 'Manchester', 'NH', '03102', '(603) 628-3544', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1488, 'New Hampshire Society Of Cpa''s', '1750 Elm Street', 'Manchester', 'NH', '03104', '(603) 622-1999', 'http://www.nhscpa.org', 'info@nhscpa.org', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nCrematories & Cremation Services\n'); INSERT INTO `default_table` VALUES (1489, 'Shelters Of New England', '251 West Hollis Street', 'Nashua', 'NH', '03060', '(603) 595-2642', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1490, 'Fauna Rescue Inc', '48 Bridge Street', 'Nashua', 'NH', '03060', '(603) 889-5035', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1491, 'Proctor Animal Cemetery', '24 Ferry Road', 'Nashua', 'NH', '03064', '(603) 889-2275', '', 'info@nhpetexpo.com', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1492, 'Humane Society For Greater Nashua', '24 Ferry Road', 'Nashua', 'NH', '03064', '(603) 889-2275', 'http://www.hsfn.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1493, 'Lakes Region Humane Society', '11 Old Route 28', 'Ossipee', 'NH', '03864', '(603) 539-1077', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1494, 'Concord Merrimack County Spca', '130 Washington Street', 'Penacook', 'NH', '03303', '(603) 753-6751', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1495, 'New Hampshire SPCA', '104 Portsmouth Avenue', 'Stratham', 'NH', '03885', '(603) 772-2921', 'http://www.nhspca.org', 'info@nhspca.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1496, 'Monadnock Canine Academy', '101 West Swanzey Road', 'Swanzey', 'NH', '03446', '(603) 352-9011', 'http://www.monadpets.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nGreat Class Selection Certified Pet Dog Trainers, Private lessons - Boarding Available - State of the Art Facility, All Proceeds Support The Homeless\n'); INSERT INTO `default_table` VALUES (1497, 'Faarm', '2 Walker Pond Road', 'Webster', 'NH', '03303', '(603) 648-2971', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1498, 'Monadpets', '101 West SWanzey Road', 'West Swanzey', 'NH', '03446', '(603) 352-9011', 'http://www.monadpets.org', '', '', 'Wed 07:30am-09:00pm', '\nProducts & Services:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nPuppy Through Advanced, All Levels of Agility, Award Winning Dog, Freestyle, ricks, Kids & Dogs Classes. Dog-Dog Aggression Classes, Small Group Class\n'); INSERT INTO `default_table` VALUES (1499, 'American Society For The Prevention Of Cruelty To Animals', '424 East 92', 'Manhattan', 'NY', '10128', '(212) 876-7700', 'http://www.aspca.org', '', '', '', '\nProducts & Services:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nEvery Animal Is Vaccinated, Neutered & Micro chipped, Our Counselors Help You, Open 7 Days A Week.\n'); INSERT INTO `default_table` VALUES (1500, 'Monmouth County SPCA Animal Shelter', '260 Wall St', 'Eatontown', 'NJ', '07724', '(732) 542-0040', 'http://www.monmouthcountyspca.org', 'spcashelter@aol.com', 'Local Non-Profit Organization Dedicated To The Health And Well-Being Of Animals', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (1501, 'Ocean County Board Of Health', '175 Sunset Avenue', 'Toms River', 'NJ', '08755', '(732) 341-9700', 'http://www.ochd.org', 'info@ochd.org', 'An Ocean County Tradition Of Trust Since 1924', 'Mon-Fri: 08:00am-05:00pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1502, 'Humane Society Of Atlantic County', '1801 Absecon Boulevard', 'Atlantic City', 'NJ', '08401', '(609) 344-0346', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1503, 'Humane Society Of Bergen County Lost Pet Inc', '221 Stuyvesant Avenue', 'Lyndhurst', 'NJ', '07071', '(201) 896-9300', 'http://www.humanesocietybergen.org', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nEUKANUBA, INNOVA, All Pet Foods, Flea & Tick Controls, Dog Beds\n'); INSERT INTO `default_table` VALUES (1504, 'Humane Society Of Atlantic County', '1801 Absecon Boulevard', 'Atlantic City', 'NJ', '08401', '(609) 344-0346', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1505, 'Aunt Mary''s Dog House Inc', '8 Union Brick Road', 'Blairstown', 'NJ', '07825', '(908) 362-1333', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1506, 'Friends Of The Bloomfield Animal Shelter', '61 Bukowski Place', 'Bloomfield', 'NJ', '07003', '(973) 259-0016', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1507, 'Bloomingdale Animal Shelter', '23 Brandt Lane', 'Bloomingdale', 'NJ', '07403', '(973) 838-2220', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1508, 'Bloomingdale Animal Control', '23 Brandt Lane', 'Bloomingdale', 'NJ', '07403', '(973) 838-8959', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1509, 'Jersey Shore Animal Center', '185 Brick Boulevard', 'Brick', 'NJ', '08723', '(732) 920-1600', 'http://www.jerseyshoreanimalcenter.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1510, 'Dog Warden', '100 Commons Way', 'Bridgewater', 'NJ', '08807', '(908) 725-0308', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1511, 'Marine Mammal Stranding Center', '3625 Atlantic Brigantine', 'Brigantine', 'NJ', '08203', '(609) 266-0538', 'http://www.marinemammalstrandingcenter.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nOver bridge and 2 miles N.\nDescription:
\nThis is one of the few marine mammal rescue and rehabilitation centers in the United States. Injured dolphins, turtles, and other marine animals are brought to the center for treatment and then... (Show More)\nThis is one of the few marine mammal rescue and rehabilitation centers in the United States. Injured dolphins, turtles, and other marine animals are brought to the center for treatment and then released back into the wild. The museum offers exhibits on mammal species, recuperating animals can be viewed at the center. Dolphin and whale-watch trips are available (fee, reservations required). (Visiting hours change seasonally or according to daily activities and operations, call for schedule)  (Show Less)\n'); INSERT INTO `default_table` VALUES (1512, 'Ladies Animal Rescue Center Inc', '113 Linden Avenue', 'Browns Mills', 'NJ', '08015', '(609) 893-0995', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1513, 'Animal Welfare Society of Cape May County Inc', '40 South Delsea Drive', 'Cape May Court House', 'NJ', '08210', '(609) 465-3403', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1514, 'Cape May County Animal Shelter', '110 Shelter Road', 'Cape May Court House', 'NJ', '08210', '(609) 465-8923', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1515, 'Cape May County Animal Shelter Alliance', '110 Shelter Road', 'Cape May Court House', 'NJ', '08210', '(609) 465-6388', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1516, 'Passaic County Pet Adoption Service Inc', '138 Louise Street', 'Clifton', 'NJ', '07011', '(973) 772-5832', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1517, 'Blumig Kennel', '645 Old Stage Road', 'East Brunswick', 'NJ', '08816', '(732) 251-3210', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1518, 'Middlesex County SPCA Law Enforcement Division', '2 Brier Hill Court', 'East Brunswick', 'NJ', '08816', '(732) 257-3103', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1519, 'Mt Pleasant Animal Shelter', '194 State Highway No 10', 'East Hanover', 'NJ', '07936', '(973) 386-0590', 'http://www.njshelter.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPuppy Kindergarten, Basic Training For Older Dogs, Agility, Canine Good Citizen, Therapy Dog, Private Sessions For Behavior Medification, Experienced Trainers, Humane Methods\n'); INSERT INTO `default_table` VALUES (1520, 'Wessex Animal Welfare League', '194 State Route 10', 'East Hanover', 'NJ', '07936', '(973) 386-0590', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPuppy Kindergarten, Basic Training For Older Dogs, Agility, Canine Good Citizen, Therapy Dog, Private Sessions For Behavior Modification, Experienced Trainers, Humane Methods\n'); INSERT INTO `default_table` VALUES (1521, 'Humane Societies', '2960 Shafto Road', 'Eatontown', 'NJ', '07724', '(732) 922-0100', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1522, 'Monmouth County SPCA Animal Shelter', '260 Wall St', 'Eatontown', 'NJ', '07724', '(732) 542-0040', 'http://www.monmouthcountyspca.org', 'spcashelter@aol.com', 'Local Non-Profit Organization Dedicated To The Health And Well-Being Of Animals', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (1523, 'Monmouth County SPCA Spay-Neuter Clinic', '260 Wall Street', 'Eatontown', 'NJ', '07724', '(732) 542-3125', 'http://www.monmouthcountyspca.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nA Non-Profit Organization, Your Donation Makes Us Possible, Low Cost, Spaying / Neutering, Gordon Robinson, VMD\n'); INSERT INTO `default_table` VALUES (1524, 'NJ Grayhound Adoptn PROG Inc', '723 County Road 625', 'Hampton', 'NJ', '08827', '(908) 713-9344', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1525, 'People For Animal Spay & Neuter', '401 Hillside Avenue', 'Hillside', 'NJ', '07205', '(973) 282-0890', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1526, 'People For Animals Inc', '401 Hillside Avenue', 'Hil', 'NJ', '07112', '(973) 282-0890', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1527, 'Ocean County Animal Facility', '615 Freemont Avenue', 'Jackson', 'NJ', '08527', '(732) 657-8086', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1528, 'The Assisi Center', '480 Johnston Avenue', 'Jersey City', 'NJ', '07304', '(201) 435-3557', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1529, 'Liberty Humane Society', '235 Communipaw Avenue', 'Jersey City', 'NJ', '07304', '(201) 547-4147', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1530, 'Liberty Humane Society', '235 Jersey City Boulevard', 'J Cy', 'NJ', '07302', '(201) 547-8380', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1531, 'Lakeland Animal Haven', '29 Pine Street', 'Kenvil', 'NJ', '07847', '(973) 584-1415', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1532, 'Noah''s Ark Animal Welfare Association - Shelter', '1915 US Highway 46 West', 'Ledgewood', 'NJ', '07852', '(973) 347-0378', 'http://www.noahsarknj.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1533, 'Noah''s Ark Animal Welfare Association Inc - Spay/Neuter', '1915 US Highway 46 West', 'Ledgewood', 'NJ', '07852', '(973) 347-5469', 'http://www.noahsarknj.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1534, 'Noah''s Ark Animal Welfare Association - Business Office', '1915 US Highway 46 West', 'Ledgewood', 'NJ', '07852', '(973) 347-4499', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1535, 'Animal Adoption Center', '501 Berlin Road North', 'Lindenwold', 'NJ', '08021', '(856) 435-9116', 'http://www.animaladoption.com', 'info@animaladoption.com', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1536, 'Kindness Korner', '221 Stuyvesant Avenue', 'Lyndhurst', 'NJ', '07071', '(201) 896-9300', 'http://www.humanesocietybergen.org', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nAll Pet Supplies, At Great Rates, Where Your Purchases Help Other Animals, All Pet Foods, Flea & Tick Controls, Dog Beds, Knowledgeable Staff, Pet Adoptions Every Day, See Our Money Saving Coupons... (Show More)\nAll Pet Supplies, At Great Rates, Where Your Purchases Help Other Animals, All Pet Foods, Flea & Tick Controls, Dog Beds, Knowledgeable Staff, Pet Adoptions Every Day, See Our Money Saving Coupons On wwwhumanesocietybergenorg, Humane Society Of Bergen County/LostPet Inc  (Show Less)\n'); INSERT INTO `default_table` VALUES (1537, 'Ocean County Animal Shelter', '321 Hay Road', 'Manahawkin', 'NJ', '08050', '(609) 978-0127', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1538, 'KiSta Ferret Rescue', '215 East Bay Avenue Unit 22', 'Manahawkin', 'NJ', '08050', '(609) 978-8588', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1539, 'Cape May County Animal Shelter Alliance - 465-Neut', '110 Shelter Road', 'Middletown', 'NJ', '07748', '(609) 465-6388', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1540, 'Clinton Township - Dog Warden', '576 Stamets Road', 'Milford', 'NJ', '08848', '(908) 996-2525', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1541, 'Hunterdon County Spca', '576 Stamets Road', 'Milford', 'NJ', '08848', '(908) 996-2525', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1542, 'Society For The Prevention Of Cruelty To Animals', '576 Stamets Road', 'Milford', 'NJ', '08848', '(908) 996-2525', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1543, 'Raptor Trust', '1390 Whitebridge Road', 'Millington', 'NJ', '07946', '(908) 647-2353', 'http://www.theraptortrust.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1544, 'Paws Inc Animal Shelter', '77 North Willow Street', 'Montclair', 'NJ', '07042', '(973) 746-5212', 'http://www.paws.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1545, 'Associated Humane Societies', '124 Evergreen Avenue', 'Newark', 'NJ', '07114', '(973) 824-7080', 'http://www.ahscares.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1546, 'Ahs Veterinary Clinic', '124 Evergreen Avenue', 'Newark', 'NJ', '07114', '(973) 824-7080', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1547, 'Golden Re''triever Rescue Inc', '125 Union Valley Road', 'Newfoundland', 'NJ', '07435', '(973) 208-7414', 'http://www.grrinews.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1548, 'R S Animal Shelter', '81 Almond Road', 'Norma', 'NJ', '08318', '(856) 691-4333', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1549, 'Ramapo-Bergen Animal Refuge', '2 Shelter Lane', 'Oakland', 'NJ', '07436', '(201) 337-5180', 'http://www.rbari.org', '', '', 'Tuesday-Thursday-10 Am To 8 Pm Saturday-Sunday-11 Am To 4 Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1550, 'South Jersey Animal Services', '46 West Avenue', 'Ocean City', 'NJ', '08226', '(609) 399-0199', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1551, 'Ocean City City - Humane Society', '1 Shelter Road', 'Ocean City', 'NJ', '08226', '(609) 399-2018', 'http://hsoc.petfinder.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt A Pet, Low Cost Spay Clinic, A Truly No-Kill Shelter, Adoption Of Dogs And Cats, Educational Services, Cat & Dog Adoptions, Spay/Neuter Clinic\n'); INSERT INTO `default_table` VALUES (1552, 'Almost Home Animal Shelter', '9140 Pennsauken Suite C', 'Pennsauken', 'NJ', '08110', '(856) 663-3058', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1553, 'Garden State Humane Society', '1 Pennsauken Creek', 'Pennsauken', 'NJ', '08110', '(856) 663-3748', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1554, 'West Jersey Animal Shelter', '217 Griffith Morgan Lane', 'Pennsauken', 'NJ', '08110', '(856) 486-2180', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1555, 'Township Of Pennsville -Dog Pound', '94 Industrial Park Road', 'Pennsville', 'NJ', '08070', '(856) 851-1100', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1556, 'Mylestone Equine Rescue', '227 Still Valley Road', 'Phillipsburg', 'NJ', '08865', '(908) 995-9300', 'http://www.mylestone.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1557, 'Woodlands Wildlife Refuge', '676 County Road 513', 'Pittstown', 'NJ', '08867', '(908) 730-8300', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1558, 'Plainfield Area Humane Society', '75 Rock Avenue', 'Plainfield', 'NJ', '07063', '(908) 754-0300', 'http://www.pahs.petfinder.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1559, 'Atlantic County Animal Shelter', '240 Old Turnpike', 'Pleasantville', 'NJ', '08232', '(609) 485-2345', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1560, 'Patch', '26 Lakeside Avenue', 'Pompton Lakes', 'NJ', '07442', '(973) 835-7202', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1561, 'SAVE Princeton Small Animal Rescue League', '900 Herrontown Road', 'Prnctn Twp', 'NJ', '08540', '(609) 921-6122', 'http://www.save-animals.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1562, 'A.L.E.R.T. (Animal Law Enforcement Response Team)', '1092 St.Georges Avenue-P.O.Box 121', 'Rahway', 'NJ', '07065', '(908) 755-2110', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1563, 'Franklin Township - Animal Shelter, Municipal Ofc, Planning & Zoning', '475 Demott Lane', 'Somerset', 'NJ', '08873', '(732) 873-2500', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nBass Lessons, Years Of Exp With All Types Of Music, Will Tailor Sessions To Your Style, Private Instruction In The Comfort Of Your Home\n'); INSERT INTO `default_table` VALUES (1564, 'Somerset Regional Animal Shelter', '100 Commons Way', 'Somerville', 'NJ', '08876', '(908) 725-0308', 'http://www.sraf.petfinder.com', '', '', 'Tuesday-Saturday 12:00Pm-4:00Pm,thursday 12:00Pm-6:00Pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nPets For Adoption, Payment By Cash Or Check\n'); INSERT INTO `default_table` VALUES (1565, 'Jersey Animal Coalition Inc', '298 Walton Avenue', 'South Orange', 'NJ', '07079', '(973) 763-7322', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1566, 'Room for One More', '243 Sparta Avenue', 'Sparta', 'NJ', '07871', '(973) 729-5225', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1567, 'Common Sense For Animals', '2420 State Route 57', 'Stewartsville', 'NJ', '08886', '(908) 859-3060', 'http://www.commonsenseforanimals.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1568, 'Bergen County - Animal Shelter', '100 United Lane', 'Teterboro', 'NJ', '07608', '(201) 229-4600', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1569, 'Associated Humane Societies', '2960 Shafto Road', 'Tinton Falls', 'NJ', '07753', '(732) 922-0100', 'http://www.associatedhumanesocieties.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1570, 'Ocean County Board Of Health', '175 Sunset Avenue', 'Toms River', 'NJ', '08755', '(732) 341-9700', 'http://www.ochd.org', 'info@ochd.org', 'An Ocean County Tradition Of Trust Since 1924', 'Mon-Fri: 08:00am-05:00pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1571, 'Ewing Township Animal Shelter', '560 West Ingham Avenue', 'Trenton', 'NJ', '08638', '(609) 393-9608', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1572, 'Ewing Township Animal Shelter', '560 West Ingham Avenue', 'Trenton', 'NJ', '08638', '(609) 393-9602', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1573, 'Patches', '558 Bloomfield', 'Verona', 'NJ', '07044', '(973) 239-4040', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1574, 'Society Prevention Cruelty of Animals', '1244 North Delsea Drive', 'Vineland', 'NJ', '08360', '(856) 691-1500', 'http://www.petfinder.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1575, 'Animal Welfare Association', '509 Centennial Boulevard', 'Voorhees', 'NJ', '08043', '(856) 424-2288', 'http://awanj.org', '', '', 'Mon-Fri/Weekdays', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLow Cost Spay/Neuter Clinic, Pets For Adoption Surgeries\n'); INSERT INTO `default_table` VALUES (1576, 'Warren Hills Animal Society Inc', '88 West Stewart Street', 'Washington', 'NJ', '07882', '(908) 689-4425', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1577, 'Wayne Animal Shelter', '187 Dey Road', 'Wayne', 'NJ', '07470', '(973) 694-0767', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1578, 'Burlington County - Animal Shelter', '35 Academy Drive', 'Westampton', 'NJ', '08060', '(609) 265-5073', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1579, 'Burlington County - Prosecutor''s Office, Public Safety', '1 Academy Drive', 'Westampton', 'NJ', '08060', '(609) 261-3900', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1580, 'Burlington County Central Communications', '795 Woodlane Road', 'Westampton', 'NJ', '08060', '(609) 261-3900', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1581, 'Joanne''s Christmas Clips,LLC Professional Mobile Dog Grooming', '4 westview drive', 'Whippany', 'NJ', '07981', '(973) 887-2995', '', '', '', 'Mon-Fri: 08:30 AM-04:00 PM', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nI bring the best, professional dog grooming to you. Generator, no plug in. 1 hour your pet is bathed, fluffed, and trimmed the way you want.\n'); INSERT INTO `default_table` VALUES (1582, 'New Jersey Schnauzer Rescue Network', '7 Stone Creek Lane', 'Whitehouse Station', 'NJ', '08889', '(908) 534-2225', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1583, 'Defenders of Wildlife', '824 Gold Avenue Southwest', 'Albuquerque', 'NM', '87102', '(505) 248-0118', 'http://www.defenders.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1584, 'Res-Care New Mexico Inc', '2301 Yale Boulevard Southeast', 'Albuquerque', 'NM', '87106', '(505) 768-5000', '', '', '', '', '\nAdditional Information:
\nGroup Homes\n'); INSERT INTO `default_table` VALUES (1585, 'Humane Animal Association of New Mexico Inc', '615 Virginia Street Northeast', 'Albuquerque', 'NM', '87108', '(505) 255-5523', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1586, 'Animal Shelter', '2135 Onate Road Southeast', 'Deming', 'NM', '88030', '(505) 546-2024', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1587, 'Deming Humane Society', '2135 Onate Road Southeast', 'Deming', 'NM', '88030', '(505) 546-2024', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1588, 'Farmington City Government', '800 Municipal Drive', 'Farmington', 'NM', '87401', '(505) 327-7701', 'http://www.fmtn.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1589, 'Farmington Animal Shelter', '1395 South Lake', 'Farmington', 'NM', '87402', '(505) 599-1098', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Additional Information:
\nAfter 6 pm Weekdays, All Day Sunday & Holidays\n'); INSERT INTO `default_table` VALUES (1590, 'Rescare of New Mexico', '525 East Lohman Avenue Suite D', 'Las Cruces', 'NM', '88001', '(505) 523-1750', '', '', '', '', '\nAdditional Information:
\nDisability Services\n'); INSERT INTO `default_table` VALUES (1591, 'Safe Haven Animal Sanctuary', '144 Wyatt Drive', 'Las Cruces', 'NM', '88005', '(505) 527-4544', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1592, 'Animal Shelter', '3551 Bataan Memorial West', 'Las Cruces', 'NM', '88012', '(505) 382-0018', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1593, 'Dona Ana County Humane Society Inc', '3551 Bataan Memorial West', 'Las Cruces', 'NM', '88012', '(505) 382-0018', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1594, 'Humane Society Inc', '3551 Bataan Memorial West', 'Las Cruces', 'NM', '88012', '(505) 382-0018', '', '', '', 'Monday-Friday 12:00Md 6:00Pm,saturday-Sunday 12:00Md 5:00Pm,open 7 Days A Week', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1595, 'Animal Control Center', '83 Galloway Road', 'Moriarty', 'NM', '87035', '(505) 832-2043', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1596, 'Estancia Valley Regional Animal Regional Shelter', '83 Galloway Road', 'Moriarty', 'NM', '87035', '(505) 832-9597', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1597, 'Humane Society Of Lincoln County-Shelter', '430 Gavilan Canyon Road', 'Ruidoso', 'NM', '88345', '(505) 257-9841', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1598, 'Humane Society Administration', '613 Sudderth Drive', 'Ruidoso', 'NM', '88345', '(505) 257-6201', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1599, 'Animal Shelter & Humane Society', '1920 Cerrillos Road', 'Santa Fe', 'NM', '87505', '(505) 983-4309', 'http://www.sfhumanesociety.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1600, 'Santa Fe Animal Shelter', '100 Caja Del Rio', 'Santa Fe', 'NM', '87507', '(505) 983-4309', 'http://www.sfhumanesociety.org', '', '', 'Monday-friday 11:00am-5:30pm
Sunday 11:00am-3:00pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Adoptions, Spay/Neuter Clinics, Volunteer Opportunities, Humane Education Classes, Visit Our Adoptable Animals & Find Our Map On Our Website\n'); INSERT INTO `default_table` VALUES (1601, 'Grant County Humane Society Inc', '3050 Cougar Way', 'Silver City', 'NM', '88061', '(505) 538-9261', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1602, 'Taos Animal Shelter', '1200 Saint Francis Lane', 'Taos', 'NM', '87571', '(505) 758-2981', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1603, 'Humane Society Of Taos Inc', '1200 Saint Francis Lane', 'Taos', 'NM', '87571', '(505) 758-2981', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1604, 'American Society For The Prevention Of Cruelty To Animals', '424 East 92', 'Manhattan', 'NY', '10128', '(212) 876-7700', 'http://www.aspca.org', '', '', '', '\nProducts & Services:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nEvery Animal Is Vaccinated, Neutered & Micro chipped, Our Counselors Help You, Open 7 Days A Week.\n'); INSERT INTO `default_table` VALUES (1605, 'Kent Animal Shelter', '2259 River Road', 'Calverton', 'NY', '11933', '(631) 727-5731', 'http://www.kentanimalshelter.com', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nLow Cost Spay / Neuter / Vaccination, Pet Adoption Center\n'); INSERT INTO `default_table` VALUES (1606, 'The Interfaith Partnership For The Homeless', '176 Sheridan Avenue', 'Albany', 'NY', '12210', '(518) 434-7397', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1607, 'Guilderland Town - Animal Shelter', '6363 Frenchs Mill Road', 'Altamont', 'NY', '12009', '(518) 861-6855', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1608, 'Montgomery County Spca', '1007 State Highway 5', 'Amsterdam', 'NY', '12010', '(518) 842-8050', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1609, 'SPCA', '1439 Pontiac Road', 'Angola', 'NY', '14006', '(716) 549-5300', 'http://www.spcaec.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1610, 'Saves Inc', '4 Josica Drive', 'Aquebogue', 'NY', '11931', '(631) 722-0015', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1611, 'Adopt-A-Dog Inc', '23 Cox Avenue', 'Armonk', 'NY', '10504', '(914) 273-1674', 'http://www.adoptadog.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1612, 'Adopt-A-Dog Inc', '23 Cox Avenue', 'Armonk', 'NY', '10504', '(914) 629-9494', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1613, 'Pet Finders', '661 High Street', 'Athol', 'NY', '12810', '(518) 623-2164', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1614, 'Finger Lakes S P C A Of Central New York', '41 York Street', 'Auburn', 'NY', '13021', '(315) 253-5841', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1615, 'Animal Shelter', '6010 County Farm Road', 'Ballston Spa', 'NY', '12020', '(518) 885-4113', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1616, 'Animal Rescue Foundation', '60 Simmons Lane', 'Beacon', 'NY', '12508', '(845) 831-5161', 'http://www.arfbeacon.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1617, 'Mid-Hudson Animal Aid Inc', '60 Simmons Lane', 'Beacon', 'NY', '12508', '(845) 831-4321', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1618, 'Advanced Termite & Pest Control Inc', '323 Broadway', 'Bethpage', 'NY', '11714', '(516) 942-2333', '', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nDEAL DIRECTLY WITH OWNER ALL WORK GUARANTEED, SPECIALIZING IN TERMITES WITH SUBTERFUGE BAITING SYSTEM/CHEMICAL TREATMENTS & WILDLIFE REMOVAL, CARPENTER ANTS, ROACHES, BEES, FLEAS, FHA-VA CLEARING... (Show More)\nDEAL DIRECTLY WITH OWNER ALL WORK GUARANTEED, SPECIALIZING IN TERMITES WITH SUBTERFUGE BAITING SYSTEM/CHEMICAL TREATMENTS & WILDLIFE REMOVAL, CARPENTER ANTS, ROACHES, BEES, FLEAS, FHA-VA CLEARING CERTIFICATES, FREE ESTIMATES LICENSED INSURED, RELIABLE SERVICE/AFFORDABLE PRICES/SENIOR DISCOUNT  (Show Less)\n'); INSERT INTO `default_table` VALUES (1619, 'Speak Animal Hospital PC', '351 Flint Road', 'Binghamton', 'NY', '13905', '(607) 729-7368', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nComplete and Compassionate Pet Health Care, Low Cost Spay/Neuter, X-ray and Testing Equipment, Flea Control, Pet Allergies/Skin Care, Prescription Foods\n'); INSERT INTO `default_table` VALUES (1620, 'Weaver Lisa M', '351 Flint Road', 'Binghamton', 'NY', '13905', '(607) 729-7368', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1621, 'Smith Suzanne DVM', '351 Flint Road', 'Binghamton', 'NY', '13905', '(607) 729-7368', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1622, 'Humane Society', '2 Jackson Street', 'Binghamton', 'NY', '13903', '(607) 724-3709', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1623, 'Project Paw Inc', '127 Bevier Street', 'Binghamton', 'NY', '13904', '(607) 724-2241', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1624, 'Broome County Government - Dog Shelter', '110 Cutler Pond Road', 'Binghamton', 'NY', '13905', '(607) 778-2493', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1625, 'Front Street Dog Shelter', '110 Cutler Pond Road', 'Binghamton', 'NY', '13905', '(607) 778-2493', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1626, 'Humane Society', '218 North State Road', 'Briarcliff', 'NY', '10510', '(914) 941-2894', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1627, 'Spca Hotline 24 Hrs', '590 North State Road', 'Briarcliff Manor', 'NY', '10510', '(914) 941-7797', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1628, 'SPCA of Westchester & Simpson Spay Neuter Clinic', '590 North State Road', 'Briarcliff Manor', 'NY', '10510', '(914) 941-2894', 'http://www.spca914.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nProtecting Animal Welfare By Providing, Low Cost Spay & Neuter, Shelter And Rehabilitation, Pet Adoption, Outreach Programs, Animal Cruelty Investigations, Help In Locating Lost Pets, A Non-Profit... (Show More)\nProtecting Animal Welfare By Providing, Low Cost Spay & Neuter, Shelter And Rehabilitation, Pet Adoption, Outreach Programs, Animal Cruelty Investigations, Help In Locating Lost Pets, A Non-Profit Organization  (Show Less)\n'); INSERT INTO `default_table` VALUES (1629, 'Fulton County SPCA', '486 Stevers Mills Road', 'Broadalbin', 'NY', '12025', '(518) 883-4009', 'http://www.fcspca.freeservers.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1630, 'Riverdale Animal House', '3605 Riverdale Avenue', 'Bronx', 'NY', '10463', '(718) 432-9396', 'http://www.riverdaleanimalhouse.com', 'info@riverdaleanimalhouse.com', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1631, 'Advanced Monitored Caregiving Inc', '1002 Quentin', 'Brooklyn', 'NY', '11223', '(718) 336-0508', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1632, 'Caregiving Advanced Monitoring', '1729 East 12th Street', 'Brooklyn', 'NY', '11229', '(718) 645-2273', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1633, 'Advanced Monitored Caregiving Inc', '1729 East 12th', 'Brooklyn', 'NY', '11229', '(718) 645-1690', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1634, 'West Seneca Town - Dog Warden & Animal Shelter', '500 Mineral Springs Road', 'Buffalo', 'NY', '14224', '(716) 823-2988', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1635, 'Kent Animal Shelter', '2259 River Road', 'Calverton', 'NY', '11933', '(631) 727-5731', 'http://www.kentanimalshelter.com', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nLow Cost Spay / Neuter / Vaccination, Pet Adoption Center\n'); INSERT INTO `default_table` VALUES (1636, 'Animal Arc', '117 Old Route 10', 'Canajoharie', 'NY', '13317', '(518) 673-5027', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1637, 'Happy Tails Animal Shelter Humane Society Of Ontario County', '2976 County Road 48', 'Canandaigua', 'NY', '14424', '(585) 396-4590', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1638, 'Four Season Animal Damage Control', '2 Depot', 'Canisteo', 'NY', '14823', '(607) 698-2097', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1639, 'Save Our Strays', '2022 College Point Boulevard', 'College Point', 'NY', '11356', '(718) 762-2277', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1640, 'Society For The Prevention Of Cruelty To Animals', '4845 State Highway 28', 'Cooperstown', 'NY', '13326', '(607) 547-8111', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1641, 'Adirondack Save A Stray', '4880 Route 9N', 'Corinth', 'NY', '12822', '(518) 654-6220', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1642, 'SPCA', '879 McLean Road', 'Cortland', 'NY', '13045', '(607) 753-9386', 'http://www.cortlandspca.baka.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1643, 'Greyhound Rescue & Rehabilitation', '42 Winterberry Circle', 'Cross River', 'NY', '10518', '(914) 763-2221', 'http://www.greyhoundrescuerehab.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1644, 'Dewitt Animal Hosp - Evening Hours, House Calls & Boarding', '5620 Thompson Road', 'De Witt', 'NY', '13214', '(315) 446-1200', '', '', '', 'Open Evenings', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAnimal, 45Years of Caring, Our Professional, Internal Medicine, Robert S. Wilcox DVM, Scott R. Pawling DVM, C. Barry Quinn DVM\n'); INSERT INTO `default_table` VALUES (1645, 'Wilcox Robert Dr Veterinarian', '5620 Thompson Road', 'De Witt', 'NY', '13214', '(315) 446-1200', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1646, 'Acme Lawn Care', '359 State Route 38 # 3', 'Dryden', 'NY', '13053', '(607) 844-8689', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nDIAL TOLL FREE - 1-800-836-0873, 359 South St. Dryden, N.Y., ACME, LAWN CARE, Weed & Feed, Grub Control, Total Weed Kill, CUSTOM APPLICATIONS, TO SUIT YOUR NEEDS, CALL\n'); INSERT INTO `default_table` VALUES (1647, 'Long Island Greyhound Transfer Inc', '89 Pengon Circle', 'East Meadow', 'NY', '11554', '(516) 735-6073', 'http://www.ligreyhound.org', 'info@ligreyhound.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1648, 'Friends Of The Schuyler County Animal Shelter', '11 Woodsview Drive', 'Elmira', 'NY', '14903', '(607) 562-8085', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1649, 'Animal Care Council Spay & Neuter Program', '131 Washington Avenue', 'Endicott', 'NY', '13760', '(607) 786-7729', 'http://www.animalcarecouncil.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1650, 'The Humane Society At Lollypop Farm', '99 Victor Road', 'Fairport', 'NY', '14450', '(585) 223-1330', 'http://www.lollypop.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLearn From The Experts, All Dog Obedience Classes\n'); INSERT INTO `default_table` VALUES (1651, 'Chautauqua County Humane Society - Stray Animal Shelter', '1805 East Elmwood Avenue', 'Falconer', 'NY', '14733', '(716) 665-4149', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nHumane Societies\n'); INSERT INTO `default_table` VALUES (1652, 'Animal Haven Inc', '3522 Prince Street', 'Flushing', 'NY', '11354', '(718) 886-3683', '', 'info@animalhavenshelter.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1653, 'Freeport Humane Society', '2 Rider Place', 'Freeport', 'NY', '11520', '(516) 378-4340', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1654, 'Long Island Humane & Dog Protective Association Inc', '2 Rider Place', 'Freeport', 'NY', '11520', '(516) 378-4340', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1655, 'Lewis County - Humane Society', '6388 Pine Grove Road', 'Glenfield', 'NY', '13343', '(315) 376-8349', 'http://www.lewishumane.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nMember ABKA, BOARDING OF DOGS CATS & SMALL ANIMALS, DAILY & MONTHLY RATES AVAILABLE, CLIFF COOK\n'); INSERT INTO `default_table` VALUES (1656, 'Whispering Pines Boarding Kennel', '6388 Pine Grove Road', 'Glenfield', 'NY', '13343', '(315) 376-8349', 'http://www.lewishumane.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nMember ABKA, BOARDING OF DOGS CATS & SMALL ANIMALS, DAILY & MONTHLY RATES AVAILABLE, CLIFF COOK\n'); INSERT INTO `default_table` VALUES (1657, 'Town Of Lowville - Dog Control Officer', '6388 Pine Grove Road', 'Glenfield', 'NY', '13343', '(315) 376-8349', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1658, 'Goshen Humane Society Inc', '44 Police Drive', 'Goshen', 'NY', '10924', '(845) 294-3984', 'http://www.goshenhumanesociety.org', '', '', 'Wed, Fri And Sat 10am-2pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1659, 'Wildlife Rescue Center Of The Hamptons', '228 West Montauk Highway', 'Hampton Bays', 'NY', '11946', '(631) 728-9453', 'http://www.wildliferescuecenter.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nWildlife Clinic And Rehabilitation Center, Call Us For Humane Alternatives, Volunteers & Donations Appreciated\n'); INSERT INTO `default_table` VALUES (1660, 'Southampton Town - Animal Shelter', '102 Old Riverhead Road', 'Hampton Bays', 'NY', '11946', '(631) 728-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1661, 'Westchester Shore Humane Society Inc', '7 Harrison Avenue', 'Harrison', 'NY', '10528', '(914) 835-3332', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1662, 'Tenny Kathleen Anne Animal Shelter', '1215 Hilton Parma', 'Hilton', 'NY', '14468', '(585) 392-0995', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1663, 'Panda Project Foundation', '242 Long Island Avenue', 'Holtsville', 'NY', '11742', '(631) 207-5830', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1664, 'Columbia-Greene Humane Society', '125 Humane Society Road', 'Hudson', 'NY', '12534', '(518) 828-6044', 'http://www.cghs.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1665, 'Humane Society Deerpark', '199 Route 209', 'Huguenot', 'NY', '12746', '(845) 856-3677', '', '', '', 'Tue-Sat: 10:00am-04:30pm
Sun 01:00pm-03:00pm', '\nProducts & Services:
\n\n
Additional Information:
\nJake Vernon Animal Shelter, Bettylou Warwick Valley Humane Society, Asher Warwick Valley Humane Society, Maya Humane Society Of Middletown, Cirrus West Milford Animal Shelter, Apollo 13 Vernon... (Show More)\nJake Vernon Animal Shelter, Bettylou Warwick Valley Humane Society, Asher Warwick Valley Humane Society, Maya Humane Society Of Middletown, Cirrus West Milford Animal Shelter, Apollo 13 Vernon Animal Shelter, Baby West Milford Animal Shelter, Caesar Humane Society Of Middletown, Harley Humane Society Of Port Jervis/Deerpar  (Show Less)\n'); INSERT INTO `default_table` VALUES (1666, 'Huntington Dog Club Inc', '33 Warner Road', 'Huntington', 'NY', '11743', '(631) 368-8770', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1667, 'Little Shelter', '33 Warner Road', 'Huntington', 'NY', '11743', '(631) 368-8770', 'http://www.littleshelter.com', 'lsar98@aol.com', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1668, 'Sheltervale Pet Cemetery', '33 Warner Road', 'Huntington', 'NY', '11743', '(631) 368-8770', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1669, 'Last Hope Inc', '581 West Jericho Turnpike', 'Huntington', 'NY', '11743', '(631) 425-1884', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1670, 'Dryden Town - Dog Control Officer SPCA', '1640 Hanshaw Road', 'Ithaca', 'NY', '14850', '(607) 257-1822', 'http://www.spcaonline.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1671, 'Spca Of Tomkins County', '1640 Hanshaw Road', 'Ithaca', 'NY', '14850', '(607) 257-1822', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1672, 'SPCA', '2825 Strunk Road', 'Jamestown', 'NY', '14701', '(716) 665-2209', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1673, 'Chautauqua County Humane Society', '2825 Strunk Road', 'Jamestown', 'NY', '14701', '(716) 665-2209', 'http://www.spcapets.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1674, 'We''re Associates Inc', '100 Jericho Quadrangle', 'Jericho', 'NY', '11753', '(516) 931-5815', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1675, 'Ulster County SPCA', '20 Wiedy Road', 'Kingston', 'NY', '12401', '(845) 331-5377', 'http://www.ucspca.org', 'pets@ulster.net', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1676, 'Humane Association Of Central New York', '4915 West Taft Road', 'Liverpool', 'NY', '13088', '(315) 457-8762', 'http://www.humaneassociationcny.1hwy.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1677, 'Pet Safe', '830 Chicken Valley Road', 'Locust Valley', 'NY', '11560', '(516) 676-0808', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nProfessional Series, Installation Service Training, Locally & Family Owned, Safely Effectively & Humanely, Containing Pets Since 1994, Advanced Digital Technology, 10 Levels Of Stimulation, Three... (Show More)\nProfessional Series, Installation Service Training, Locally & Family Owned, Safely Effectively & Humanely, Containing Pets Since 1994, Advanced Digital Technology, 10 Levels Of Stimulation, Three Custom Training Modes, Exclusive Safety Shut-Off Feature, Low Battery Indicator, UL Classified, FCC Licensed, Water Resistant, Lightning Protection, Wire Break Alarm With Led, Indoor, Restriction/Containment, Installation To 100 Acres, Lifetime Warranty Included  (Show Less)\n'); INSERT INTO `default_table` VALUES (1678, 'Long Beach City - Animal Shelter', '770 Park Place', 'Long Beach', 'NY', '11561', '(516) 431-5699', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1679, 'I Love Animal Inc-For Animal Aid', '3831 28th Street', 'Long Island City', 'NY', '11101', '(718) 784-3936', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nOrganizations\n'); INSERT INTO `default_table` VALUES (1680, 'American Society For The Prevention Of Cruelty To Animals', '424 East 92', 'Manhattan', 'NY', '10128', '(212) 876-7700', 'http://www.aspca.org', '', '', '', '\nProducts & Services:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nEvery Animal Is Vaccinated, Neutered & Micro chipped, Our Counselors Help You, Open 7 Days A Week.\n'); INSERT INTO `default_table` VALUES (1681, 'We''re Associates Inc', '2 Huntington Quad Suite 1N01', 'Melville', 'NY', '11747', '(631) 249-7419', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1682, 'We''re Associates Inc', '8 Corporate Center Drive', 'Melville', 'NY', '11747', '(631) 293-1392', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1683, 'We''Re Associates Inc', '1 Huntington Quad Suite 2S04', 'Melville', 'NY', '11747', '(631) 454-9552', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1684, 'Were Associates Inc', '100 Baylis Road', 'Melville', 'NY', '11747', '(631) 752-1827', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1685, 'We''re Associates Inc', '2 Huntington Quad Suite 1N01', 'Melville', 'NY', '11747', '(631) 756-0846', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1686, 'We''Re Associates Inc', '1 Huntington Quad Suite 2S04', 'Melville', 'NY', '11747', '(631) 756-3007', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1687, 'Humane Society Of Middletown', '142 Bloomingburg Road', 'Middletown', 'NY', '10940', '(845) 361-1861', 'http://www.middletownhumanesociety.com', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Additional Information:
\nJake Vernon Animal Shelter, Bettylou Warwick Valley Humane Society, Asher Warwick Valley Humane Society, Maya Humane Society Of Middletown, Cirrus West Milford Animal Shelter, Apollo 13 Vernon... (Show More)\nJake Vernon Animal Shelter, Bettylou Warwick Valley Humane Society, Asher Warwick Valley Humane Society, Maya Humane Society Of Middletown, Cirrus West Milford Animal Shelter, Apollo 13 Vernon Animal Shelter, Baby West Milford Animal Shelter, Caesar Humane Society Of Middletown, Harley Humane Society Of Port Jervis/Deerpar  (Show Less)\n'); INSERT INTO `default_table` VALUES (1688, 'Town of Monroe Animal Shelter', '101 Mine Road', 'Monroe', 'NY', '10950', '(845) 782-0302', 'http://www.monroedogshelter.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1689, 'MT Vernon City - Animal Shelter', '600 Garden Avenue', 'Mount Vernon', 'NY', '10550', '(914) 665-2444', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1690, 'Picture Your Pet', '24 Windwood Drive', 'Newburgh', 'NY', '12550', '(845) 564-9748', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1691, 'Volunteers Of America', '172 1st Street', 'Newburgh', 'NY', '12550', '(845) 563-4710', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1692, 'We''re Associates Inc', '3003 New Hyde Park Road', 'New Hyde Park', 'NY', '11042', '(516) 326-0725', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1693, 'We''re Associates Inc', '3003 New Hyde Park Road', 'New Hyde Park', 'NY', '11042', '(516) 352-1864', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1694, 'We''re Associates Inc', '5 Dakota Drive', 'New Hyde Park', 'NY', '11042', '(516) 358-2235', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1695, 'We''re Associates Inc', '3000 Marcus Avenue', 'New Hyde Park', 'NY', '11042', '(516) 437-3983', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1696, 'We''re Associates Inc', '2800 Marcus Avenue', 'New Hyde Park', 'NY', '11042', '(516) 488-0980', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1697, 'We''re Associates Inc', '3003 New Hyde Park Road', 'New Hyde Park', 'NY', '11042', '(516) 488-7536', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1698, 'Wildlife Watch', '18 Joalyn Road', 'New Paltz', 'NY', '12561', '(845) 256-1400', 'http://www.wildwatch.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1699, 'Pet Adoption Center of Westchester', '70 Portman Road', 'New Rochelle', 'NY', '10801', '(914) 632-2925', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1700, 'New Rochelle Humane Society Adoption Center', '70 Portman Road', 'New Rochelle', 'NY', '10801', '(914) 632-2925', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1701, 'Dwight Memorial Animal Shelter', '940 Little Britain Road', 'New Windsor', 'NY', '12553', '(845) 564-6810', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1702, 'Newburgh S P C A Inc', '940 Little Britain Road', 'New Windsor', 'NY', '12553', '(845) 564-6810', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1703, 'SPCA', '940 Little Britain Road', 'New Windsor', 'NY', '12553', '(845) 564-6810', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1704, 'Salas Marcela', '348 East 9th Street Bsmt', 'New York', 'NY', '10003', '(212) 477-2688', 'http://www.stmarksvet.com', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nST. MARKS, VETERINARY HOSPITAL, 348 East 9th St. (Bet. 1st & 2nd Ave.), 7 DAYS A WEEK, Sally Haddock, DVM\n'); INSERT INTO `default_table` VALUES (1705, 'Schettino Edward', '348 East 9th Street Bsmt', 'New York', 'NY', '10003', '(212) 477-2688', 'http://www.stmarksvet.com', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nST. MARKS, VETERINARY HOSPITAL, 348 East 9th St. (Bet. 1st & 2nd Ave.), 7 DAYS A WEEK, Sally Haddock, DVM\n'); INSERT INTO `default_table` VALUES (1706, 'Iglesias Kristin', '348 East 9th Street Bsmt', 'New York', 'NY', '10003', '(212) 477-2688', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1707, 'A S P C A - Animal Shelter-Hospitals-Adoptions, Publications Office', '110 5th Avenue', 'New York', 'NY', '10011', '(212) 410-0087', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1708, 'Theresearch Associates Inc', '401 Washington Street', 'New York', 'NY', '10013', '(212) 941-7797', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1709, 'Theresearch.com', '401 Washington Street', 'New York', 'NY', '10013', '(212) 941-7797', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1710, 'Bide-A-Wee - Shelter', '410 East 38th Street', 'New York', 'NY', '10016', '(212) 532-4455', 'http://www.bideawee.org', '', 'A CENTURY OF CARING', 'Mon 08:00am-05:00pm
Tue-Sat: 10:00am-06:00pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1711, 'Bide-A-Wee Home Association - Animal Acceptances & Adoptions, Shelter Manager', '410 East 38th Street', 'New York', 'NY', '10016', '(212) 532-0536', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1712, 'Animal Haven Inc', '227 East 44th Street', 'New York', 'NY', '10017', '(212) 692-0082', '', '', '', '', '\nAdditional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1713, 'Animal Haven Inc', '227 East 44th Street', 'New York', 'NY', '10017', '(212) 692-0083', '', '', '', '', '\nAdditional Information:
\nPets & Animals Shelters\n'); INSERT INTO `default_table` VALUES (1714, 'Build A Bear Workshop', '565 5th Avenue', 'New York', 'NY', '10017', '(212) 871-7080', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1715, 'I Love Animals Inc-For Animal Aid', '120 East 73rd Street', 'New York', 'NY', '10021', '(212) 628-7100', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1716, 'Humane Society of N Y', '306 East 59th Street', 'New York', 'NY', '10022', '(212) 752-4840', 'http://www.humanesocietyny.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1717, 'Friends of Animals Inc', '1841 Broadway Rm 812', 'New York', 'NY', '10023', '(212) 247-8120', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1718, 'Amy Inc', '228 West 71', 'New York', 'NY', '10023', '(212) 723-8600', '', '', '', '', '\nAdditional Information:
\nIndependent Escort, Voluptuous Brunette, Flat Rate, Exceptional Svc, My Upscale Location Or Yours\n'); INSERT INTO `default_table` VALUES (1719, 'Woff Animal Rescue Inc', '1550 York Avenue', 'New York', 'NY', '10028', '(212) 517-7297', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1720, 'Society League Pension & Health Fund', '1501 Broadway', 'New York', 'NY', '10036', '(212) 869-8129', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1721, 'ASPCA', '424 East 92nd Street', 'New York', 'NY', '10128', '(212) 426-4357', '', '', '', '', '\nAdditional Information:
\nVeterinary Clinics & Hospitals, Animal Shelters\n'); INSERT INTO `default_table` VALUES (1722, 'Center For Animal Care And Control', '326 E 110th Street', 'New York', 'NY', '10029', '(212) 722-3620', 'http://www.nycacc.org', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (1723, 'SPCA', '6160 County Road 32', 'Norwich', 'NY', '13815', '(607) 334-9724', 'http://www.cspca.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1724, 'Oswego County Humane Society', '157 E 1st Street', 'Oswego', 'NY', '13126', '(315) 207-1040', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1725, 'Horse Rescue & Sanctuary', '7906 Dow Road', 'Pavilion', 'NY', '14525', '(585) 584-8210', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1726, 'Southold Town - Animal Shelter', '275 Peconic Lane', 'Peconic', 'NY', '11958', '(631) 765-1811', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1727, 'Little Orphan Animals Inc', '5 Rolling Way Apt K', 'Peekskill', 'NY', '10566', '(914) 734-2989', 'http://www.littleorphananimals.freehosting.net', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1728, 'Adopt-A-Puppy', '48 Evans Road', 'Pennellville', 'NY', '13132', '(315) 695-4290', '', 'adopt1pup@aol.com', '', '', '\nProducts & Services:
\n\n
Brands:
\n\n
Additional Information:
\nLessons, Equipment, Where Do You Want To Dive Today, Sherwood, Genesis, DUI\n'); INSERT INTO `default_table` VALUES (1729, 'Elmore S P C A Inc', '55 Telegraph Road', 'Peru', 'NY', '12972', '(518) 643-2451', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1730, 'Hudson Valley Humane Society', '200 Quaker Road', 'Pomona', 'NY', '10970', '(845) 354-3124', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1731, 'Rockland County - County Offices, Animal Shelter', '65 Firemans Memorial Drive', 'Pomona', 'NY', '10970', '(845) 354-7900', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1732, 'Hi-Tor Animal Care Center Inc', '65 Firemans Memorial Drive', 'Pomona', 'NY', '10970', '(845) 354-7900', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1733, 'Cat Assistance', '459 North Main Street', 'Port Chester', 'NY', '10573', '(914) 667-7877', 'http://www.catassistance.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1734, 'North Hempstead Town Animal Shelter', '75 Marino Avenue', 'Port Washington', 'NY', '11050', '(516) 944-8220', 'http://www.northhempstead.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1735, 'North Shore Animal League America', '25 Davis Avenue', 'Port Washington', 'NY', '11050', '(516) 883-7575', 'http://www.nsalamerica.org', '', 'North Shore Animals', 'M-Sun 10am-9pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nDirections-LIE Exit 36. North 4 miles. At 2nd Getty, Sta, left on Davis Ave. Just 2 blocks from LIRR Port Washington Sta., Purebreeds, Mixed Breeds, 100''s to, choose from!, ADOPT TODAY - OPEN 7... (Show More)\nDirections-LIE Exit 36. North 4 miles. At 2nd Getty, Sta, left on Davis Ave. Just 2 blocks from LIRR Port Washington Sta., Purebreeds, Mixed Breeds, 100''s to, choose from!, ADOPT TODAY - OPEN 7 DAYS!, 10am - 9pm, Sat. & Sun. too!, ADOPTER''S, BONUS  (Show Less)\n'); INSERT INTO `default_table` VALUES (1736, 'The New Pet Savers Adoption Center', '45 Page Av', 'Port Washington', 'NY', '11050', '(516) 883-7575', 'http://www.nsalamerica.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nPuppies, Kittens, Purebreeds, Mixed Breeds, 100''s To Choose From, Adopt Today, Mention Ad & Get Free Adopter''s Bonus\n'); INSERT INTO `default_table` VALUES (1737, 'Potsdam Animal Shelter', '17 Madrid Avenue', 'Potsdam', 'NY', '13676', '(315) 265-3199', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1738, 'United Friends of Homeless Animals', '432 Centerville Road', 'Richland', 'NY', '13144', '(315) 298-4733', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1739, 'The Priceless Parrot Preserve', '3 Deer Leap Road', 'Ridge', 'NY', '11961', '(631) 924-8725', 'http://www.pricelessparrot.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1740, 'Rochester-City - Police Department Public Safety Building, Animal Control Center', '184 Verona Street', 'Rochester', 'NY', '14608', '(585) 428-7274', 'http://www.bugsysanimalnetwork.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1741, 'Humane Society of Rome Inc', '6247 Lamphear Road', 'Rome', 'NY', '13440', '(315) 336-7070', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1742, 'V I P Dog Training CO Inc', '2215 Motor Parkway', 'Ronkonkoma', 'NY', '11779', '(718) 429-5050', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1743, 'The Dog Project', '95 Middle Neck Road', 'Sands Point', 'NY', '11050', '(516) 944-2000', 'http://www.dogproject.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1744, 'Wildlife Lectures', '2324 Route 32', 'Saugerties', 'NY', '12477', '(845) 246-5501', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1745, 'Farm Sanctuary', '3150 Aikens Road', 'Savona', 'NY', '14879', '(607) 583-2225', 'http://www.farmsanctuary.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1746, 'Berghash Stephen R Dvm', '3750 Scottsville Road', 'Scottsville', 'NY', '14546', '(585) 889-8340', 'http://petadoption.cc', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nFull Service Veterinary Care, Visit Our Adoption Program At petadoptioncc\n'); INSERT INTO `default_table` VALUES (1747, 'Scottsville Veterinary Hospital', '3750 Scottsville Road', 'Scottsville', 'NY', '14546', '(585) 889-8340', 'http://petadoption.cc', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nFull Service Veterinary Care Including, Supervised Boarding, Dogs & Cats For Adoption, Visit Our Adoption Program At petadoptioncc\n'); INSERT INTO `default_table` VALUES (1748, 'North Fork Animal Hospital', '53 North Ferry Road', 'Shelter Island', 'NY', '11964', '(631) 749-2506', '', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (1749, 'Delaware Valley Humane Society', '101 Main Street', 'Sidney', 'NY', '13838', '(607) 563-7780', '', '', '', 'Open 7 Days A Week 11:00Am-4:00Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1750, 'Suffolk County Society For The Prevention Of Cruelty To Animals', '363 Route 111', 'Smithtown', 'NY', '11787', '(631) 382-7722', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1751, 'Pug Rescue Of CNY Inc.', '105 Center St', 'Solvay', 'NY', '13209', '(315) 487-2500', '', '', 'Rescue, Care, & Placaement Of Pugs', '', '\nProducts & Services:
\n\n
Additional Information:
\nPro CNY Is Incorporated Under 510(C) 3 Sates, We Are A Charitable Organization, All Donations To US Are Tax Deductible\n'); INSERT INTO `default_table` VALUES (1752, 'Animal Haven Acres', '243 Doroski Road', 'South Kortright', 'NY', '13842', '(607) 538-9117', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1753, 'Ayres Memorial Animal Shelter Inc', '133 Hilltop Road', 'Sprakers', 'NY', '12166', '(518) 673-5670', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1754, 'S P C A - Cruelty Investigation Ofc', '5878 East Molloy Road', 'Syracuse', 'NY', '13211', '(315) 454-3469', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1755, 'SPCA', '5878 East Molloy Road', 'Syracuse', 'NY', '13211', '(315) 454-4479', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1756, 'Animal Shelter', '5878 East Molloy Road', 'Syracuse', 'NY', '13211', '(315) 454-4479', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPet Shops, Animal Shelters\n'); INSERT INTO `default_table` VALUES (1757, 'Wilcox Robert Dr Veterinarian', '5620 Thompson Road', 'Syracuse', 'NY', '13214', '(315) 446-1200', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal, 45Years of Caring, Our Professional, Internal Medicine, Robert S. Wilcox DVM, Scott R. Pawling DVM, C. Barry Quinn DVM\n'); INSERT INTO `default_table` VALUES (1758, 'Spay & Neuter Syracuse', '1108 Spring Street', 'Syracuse', 'NY', '13208', '(315) 422-7970', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1759, 'Society for the Prevention of Cruelty To Animals', '205 Ensminger Road', 'Tonawanda', 'NY', '14150', '(716) 875-7360', '', '', '', '', '\nAdditional Information:
\nAnimal Shelters, Pet Shops\n'); INSERT INTO `default_table` VALUES (1760, 'SPCA', '205 Ensminger Road', 'Tonawanda', 'NY', '14150', '(716) 875-7360', '', '', '', '', '\nAdditional Information:
\nAnimal Shelters, Pet Shops\n'); INSERT INTO `default_table` VALUES (1761, 'Labrador Wild Life Reserve', '7197 State Route 91', 'Tully', 'NY', '13159', '(607) 842-6425', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1762, 'Bide-A-Wee Home Association - Clinic', '3300 Beltagh Avenue', 'Wantagh', 'NY', '11793', '(516) 785-4687', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1763, 'Hempstead Town - General Services Dept, Animal Shelter & Control', '3320 Beltagh Avenue', 'Wantagh', 'NY', '11793', '(516) 785-5220', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1764, 'Bide-A-Wee - Shelter', '3300 Beltagh Avenue', 'Wantagh', 'NY', '11793', '(516) 785-4079', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1765, 'Warwick Valley Humane Society', '48 Public Works Drive', 'Warwick', 'NY', '10990', '(845) 986-2473', 'http://www.wvhumane.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Additional Information:
\nJake Vernon Animal Shelter, Bettylou Warwick Valley Humane Society, Asher Warwick Valley Humane Society, Maya Humane Society Of Middletown, Cirrus West Milford Animal Shelter, Apollo 13 Vernon... (Show More)\nJake Vernon Animal Shelter, Bettylou Warwick Valley Humane Society, Asher Warwick Valley Humane Society, Maya Humane Society Of Middletown, Cirrus West Milford Animal Shelter, Apollo 13 Vernon Animal Shelter, Baby West Milford Animal Shelter, Caesar Humane Society Of Middletown, Harley Humane Society Of Port Jervis/Deerpar  (Show Less)\n'); INSERT INTO `default_table` VALUES (1766, 'Humane Society Of Blooming Grove Inc', '2741 Route 94', 'Washingtonville', 'NY', '10992', '(845) 496-6199', 'http://www.humanesocietybg.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1767, 'Humane Society of Blooming Grove Inc - Animal Control', '2741 Route 94', 'Washingtonville', 'NY', '10992', '(845) 497-3881', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1768, 'S P C A Jefferson County', '25056 Water Street', 'Watertown', 'NY', '13601', '(315) 782-3260', 'http://www.jeffersonspca.petfinder.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1769, 'Stray Haven Humane Society', '194 Shepard Road', 'Waverly', 'NY', '14892', '(607) 565-2859', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1770, 'Northern Chautauqua Canine Rescue Inc', '7540 North Gale Street', 'Westfield', 'NY', '14787', '(716) 326-7297', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1771, 'Bide-A-Wee Home Associates', '118 Old Country Road', 'Westhampton', 'NY', '11977', '(631) 288-0574', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1772, 'Yonkers Animal Shelter', '120 Fullerton Avenue', 'Yonkers', 'NY', '10704', '(914) 375-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1773, 'Yonkers City - Parks Recreation And Conservation Department, Animal Shelter', '120 Fullerton Avenue', 'Yonkers', 'NY', '10704', '(914) 377-6730', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1774, 'Ciber Knot 2K Foundation', '5633 Hagan Stone Park Road', 'Greensboro', 'NC', '27406', '(336) 676-7280', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1775, 'Asheville Humane Society', '72 Lees Creek Road', 'Asheville', 'NC', '28806', '(828) 253-6807', 'http://www.ashevillehumane.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1776, 'Animal Haven Of Asheville', '65 Lower Grassy Branch', 'Asheville', 'NC', '28805', '(828) 299-1635', 'http://www.animalhaven.org', 'animalhaven@hotmail.com', '', 'Monday-Saturday 11:00am To 5:00pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1777, 'Paws Animal Shelter', '58 Lemons Branch Road', 'Bryson City', 'NC', '28713', '(828) 488-0418', 'http://www.pawsanimalshelter.com', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1778, 'P A W S Thrift Store', '260 Slope Street', 'Bryson City', 'NC', '28713', '(828) 488-1008', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1779, 'Animal Control Bureau-Cmpd', '8315 Byrum Drive', 'Charlotte', 'NC', '28217', '(704) 336-3786', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1780, 'Humane Society Of Charlotte Shelter & Adoption Center - Shelter', '2700 Toomey Avenue', 'Charlotte', 'NC', '28203', '(704) 377-0534', 'http://www.clthumane.org', 'info@dataaccessinc.com', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1781, 'Kennel Korner Flea Market', '2700 Toomey Avenue', 'Charlotte', 'NC', '28203', '(704) 377-0534', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1782, 'Johnston County SPCA Inc', '720 Durham Street', 'Clayton', 'NC', '27520', '(919) 553-3749', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1783, 'Red Wolf Coalition', '212 Main Street', 'Columbia', 'NC', '27925', '(252) 796-5600', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1784, 'Foothills Humane Society Inc', '989 Little Mountain Road', 'Columbus', 'NC', '28722', '(828) 863-4444', 'http://www.foothillshumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1785, 'Smoky Mtn Amimal Resource Team', '104 Front Street', 'Dillsboro', 'NC', '28725', '(828) 631-4357', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1786, 'Durham County - Animal Shelter', '2117 East Club Boulevard', 'Durham', 'NC', '27704', '(919) 560-0640', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1787, 'Animal Protection Society of Durham', '2117 East Club Boulevard', 'Durham', 'NC', '27704', '(919) 560-0640', 'http://www.apsofdurham.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1788, 'S P C A of Cumberland County', '3232 Bragg Boulevard', 'Fayetteville', 'NC', '28303', '(910) 860-1177', 'http://www.spcaofcumberlandco.bizland.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1789, 'Fayetteville Animal Protection Society', '3927 Bragg Boulevard', 'Fayetteville', 'NC', '28303', '(910) 864-9040', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1790, 'Macon County Humane Society Inc', '851 Lake Emory Road', 'Franklin', 'NC', '28734', '(828) 524-4588', 'http://www.maconhumane.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1791, 'SPCA of Wake County Pet Lost and Found Center', '327 US Highway 70 East', 'Garner', 'NC', '27529', '(919) 772-3203', 'http://www.spcawake.org', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (1792, 'Scientis I N C', '1603 North Oaks Court', 'Greensboro', 'NC', '27455', '(336) 286-3077', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1793, 'Guilford County Animal Shelter', '4525 West Wendover Avenue', 'Greensboro', 'NC', '27409', '(336) 297-5020', 'http://www.adoptshelterpets.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1794, 'Ciber Knot 2K Foundation', '5633 Hagan Stone Park Road', 'Greensboro', 'NC', '27406', '(336) 676-7280', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1795, 'Topsail Humane Society', '668 Lewis Road Southwest', 'Hampstead', 'NC', '28443', '(910) 270-2660', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1796, 'Vance County - Dog Warden, Animal Shelter', '165 Vance Academy Road', 'Henderson', 'NC', '27537', '(252) 492-3136', 'http://www.vancecounty.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1797, 'Humane Society of Catawba County', '3476 Valley Arbors Drive', 'Hickory', 'NC', '28602', '(828) 327-3878', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1798, 'Onslow County Government - Animal Shelter, Health Department, Animal Control & Shelter', '244 Georgetown Road', 'Jacksonville', 'NC', '28540', '(910) 455-0182', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1799, 'Feline Hope Animal Shelter', '843 Herbert Perry Road', 'Kitty Hawk', 'NC', '27949', '(252) 255-3365', 'http://www.felinehope.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1800, 'Humane Society Scotland County', '1401 West Boulevard', 'Laurinburg', 'NC', '28352', '(910) 276-9271', 'http://www.scotlandcountyhumanesociety.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1801, 'Independent Animal Rescue Organization Iard', '724 Broadway Road', 'Lexington', 'NC', '27295', '(336) 752-4027', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1802, 'Harnett County Animal Control Shelter', '1100 McKay Place', 'Lillington', 'NC', '27546', '(910) 814-2952', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1803, 'Lincoln County Government - Sheriff''s Department, Animal Shelter', '650 John Howell Memorial', 'Lincolnton', 'NC', '28092', '(704) 736-8734', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1804, 'Dare County - Animal Shelter', '1029 Driftwood Drive', 'Manteo', 'NC', '27954', '(252) 475-5620', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1805, 'Animal Lovers Assistance League', '204 Airport Road', 'Maple', 'NC', '27956', '(252) 457-0011', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1806, 'Animal Shelter', '7450 US 19', 'Marble', 'NC', '28905', '(828) 837-2304', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1807, 'Humane Society of Valley River', '7450 US 19', 'Marble', 'NC', '28905', '(828) 837-2304', 'http://www.valleyriverhumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1808, 'Madison CO Animal Control', '389 Long Branch Road', 'Marshall', 'NC', '28753', '(828) 649-3190', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1809, 'APS Animal Clinic Wildlife Shelter', '6311 Nicks Road', 'Mebane', 'NC', '27302', '(919) 304-2337', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1810, 'Katies Critters', '2508 Cimarron Circle', 'Midland', 'NC', '28107', '(704) 888-6628', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1811, 'Union County Animal Shelter', '4600 Goldmine Road', 'Monroe', 'NC', '28110', '(704) 283-2308', '', '', 'Adopt a Puppy, Kitten, Dog or Cat', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt A Puppy Or Kitten, Dog Or Cat\n'); INSERT INTO `default_table` VALUES (1812, 'Union County Animal Shelter', '4600 Goldmine Road', 'Monroe', 'NC', '28110', '(704) 283-8303', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1813, 'Paws Thrift Store', '1211 Bridges Street', 'Morehead City', 'NC', '28557', '(252) 247-3341', 'http://www.pawsofcarteret.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPAWS Link, AN ADOPTION OPTION\n'); INSERT INTO `default_table` VALUES (1814, 'Burke County Friends For Animals Adoption Center', '417 Kirksey Drive', 'Morganton', 'NC', '28655', '(828) 433-1115', 'http://www.bcffapetfinder.com', '', '', 'Closed Mondays', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nRescues\n'); INSERT INTO `default_table` VALUES (1815, 'Outerbanks Wildlife Shelter', '100 Wildlife Way', 'Newport', 'NC', '28570', '(252) 240-1200', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1816, 'Wild Animal Rehabilitation Center Wildarc', '1312 Old Cherry Point Road', 'New Bern', 'NC', '28560', '(252) 638-4646', 'http://www.wildarc.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1817, 'Animal Shelter-Control', '1639 Old Airport Road', 'New Bern', 'NC', '28562', '(252) 637-4606', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1818, 'Craven County Government - Health Department, Craven Pamlico Animal Services Center', '1639 Old Airport Road', 'New Bern', 'NC', '28562', '(252) 637-4606', 'http://www.cravencounty.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1819, 'Shelters Inc', '129 Badin Shores Resort', 'New London', 'NC', '28127', '(336) 461-5100', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1820, 'Hoke County - Animal Shelter Humane Society, Hoke County Animal Shelter', '700 Cc Steele Road', 'Raeford', 'NC', '28376', '(910) 875-5486', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1821, 'Haven Friends for Life', '400 Fulford McMillan Road', 'Raeford', 'NC', '28376', '(910) 875-6768', 'http://www.thehaven-nc.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1822, 'Change the World Animal Rescue', '7201 Ebenezer Church Road', 'Raleigh', 'NC', '27612', '(919) 781-0988', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1823, 'A Cats Tale', '6812 Davis Circle', 'Raleigh', 'NC', '27613', '(919) 571-2646', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1824, 'American Kennel Club - Canine Health Foundation', '5580 Centerview Drive', 'Raleigh', 'NC', '27606', '(919) 334-4010', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1825, 'American Kennel Club - Administration', '5580 Centerview Drive', 'Raleigh', 'NC', '27606', '(919) 816-3600', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1826, 'Special Pets For Special People', '200 Baytree Lane', 'Raleigh', 'NC', '27615', '(919) 844-7090', 'http://www.specialpetsforspecialpeople.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nFree Adoption Of Small Pets, ~We Will Find Your Pet A Good Home~\n'); INSERT INTO `default_table` VALUES (1827, 'Spca-Curtis DAIL Pet Adoption Center', '200 Petfinders Lane', 'Raleigh', 'NC', '27603', '(919) 772-2326', 'http://www.spcawake.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Adoptions, Neutered-Vaccinated-Dewormed, Low Cost Spay / Neuter Information\n'); INSERT INTO `default_table` VALUES (1828, 'Nc Zoo - Wildlife Rehabilitation', '2723 Old Cox Road', 'Ramseur', 'NC', '27316', '(336) 879-7644', 'http://www.nczoo.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1829, 'Humane Society of Richmond County', '529 East US 74 Highway', 'Rockingham', 'NC', '28379', '(910) 895-0335', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1830, 'Rutherford County Offices - Animal Shelter', '578 Laurel Hill Drive', 'Rutherfordton', 'NC', '28139', '(828) 287-6025', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1831, 'Robeson County Animal Center', '255 Landfill Road', 'Saint Pauls', 'NC', '28384', '(910) 865-2200', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1832, 'Paws Place Inc', '3701 Boiling Spring Road', 'Southport', 'NC', '28461', '(910) 845-7297', 'http://www.pawsplace.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1833, 'Animal Trustees Of Alleghany', '1802 Memorial Park Drive', 'Sparta', 'NC', '28675', '(336) 372-6292', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nGovernment Offices-City, Village & Township\n'); INSERT INTO `default_table` VALUES (1834, 'Mitchell County Animal Shelter Rescue', '2492 19 E Highway', 'Spruce Pine', 'NC', '28777', '(828) 765-6952', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1835, 'Tail Waggers Rescue & Retreat', '8101 Nc Highway 200', 'Stanfield', 'NC', '28163', '(704) 795-1162', 'http://www.tailwaggers.com', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1836, 'Smoky Mt Animal Resource', '104 Front Street', 'Sylva', 'NC', '28779', '(828) 631-4357', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1837, 'Chowan County - Animal Control', '138 Icaria Road', 'Tyner', 'NC', '27980', '(252) 221-8514', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1838, 'Saving Grace Animals for Adoption', '13400 Old Creedmoor Road', 'Wake Forest', 'NC', '27587', '(919) 518-1180', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1839, 'Animal Rescue of Stokes CO', '1010 Barn Road', 'Walnut Cove', 'NC', '27052', '(336) 994-2332', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1840, 'Duckys Animal Welfare', '1010 Barn Road', 'Walnut Cove', 'NC', '27052', '(336) 994-2332', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1841, 'Haywood County - Animal Shelter', '245 Hemlock Street', 'Waynesville', 'NC', '28786', '(828) 456-5338', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1842, 'Wilkes County Offices - Animal Shelter', '408 Call Street', 'Wilkesboro', 'NC', '28697', '(336) 903-7688', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1843, 'Martin County - Animal Shelter', '1411 Land Fill Road', 'Williamston', 'NC', '27892', '(252) 792-6910', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1844, 'Animal Shelter Wilson County', '4001 Airport Northwest', 'Wilson', 'NC', '27896', '(252) 291-8142', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1845, 'Franklin and Peabody Morykwas Furever Friends', '100 Hanes Mall Circle', 'Winston Salem', 'NC', '27103', '(336) 659-4927', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1846, 'AARF', '311 Harvey Street', 'Winston Salem', 'NC', '27103', '(336) 768-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1847, 'Animal Control Dept-Forsyth County', '5570 Sturmer Park Circle', 'Winston Salem', 'NC', '27105', '(336) 703-2490', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1848, 'Yadkin County Animal Shelter', '1027 Speaks Street', 'Yadkinville', 'NC', '27055', '(336) 677-2500', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1849, 'Humane Society Animal Shelter Souris Valley', '1935 20th Avenue Southeast', 'Minot', 'ND', '58701', '(701) 852-6133', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1850, 'Long Lake National Wildlife Refuge', '12000 353rd Street Southeast', 'Moffit', 'ND', '58560', '(701) 387-4397', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1851, 'U S Government - Interior Department', '12000 353rd Street Southeast', 'Moffit', 'ND', '58560', '(701) 387-4397', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1852, 'National Audubon Society', '2646 90th Avenue Southeast', 'Spiritwood', 'ND', '58481', '(701) 252-3822', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1853, 'Pet Guards Program', '950 Hardy Road', 'Akron', 'OH', '44313', '(330) 849-0634', 'http://www.petguards.com', '', '', 'Tuesday-Friday 12:00Pm-7:00Pm,saturday 10:00Am-4:00Pm,closed Sunday-Monday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLow Cost / Quality Care\n'); INSERT INTO `default_table` VALUES (1854, 'Alliance For Children & Families Inc', '70 E Columbia Street', 'Alliance', 'OH', '44601', '(330) 829-9104', '', '', '', '', '\nSpecialties:
\n\n
Additional Information:
\nAlliance Emergency Residence, Homeless Shelter For Families & Individuals\n'); INSERT INTO `default_table` VALUES (1855, 'Animal Rescue Fund Inc', '1792 State Route 125', 'Amelia', 'OH', '45102', '(513) 797-7500', '', '', '', '', '\nAdditional Information:
\nHumane Societies\n'); INSERT INTO `default_table` VALUES (1856, 'Ashland County - Animal Shelter', '1710 Garfield Avenue', 'Ashland', 'OH', '44805', '(419) 289-1455', 'http://www.ashlandcounty.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1857, 'Animal Protective League', '5970 Green Road', 'Ashtabula', 'OH', '44004', '(440) 224-1222', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1858, 'Cat Shelters', '8500 Hoon Drive', 'Athens', 'OH', '45701', '(740) 592-6047', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1859, 'Animal Welfare League', '4193 Taylor Road', 'Batavia', 'OH', '45103', '(513) 735-2299', 'http://www.lfaw.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nNo Kill/Non Profit, Animal Hospital, See Dogs & Cats Available For Adoption\n'); INSERT INTO `default_table` VALUES (1860, 'Animal Rescue Fund Inc', '295 Haskell Lane', 'Batavia', 'OH', '45103', '(513) 735-4000', 'http://www.animal-rescue-fund.org', '', '', '', '\nAdditional Information:
\nHumane Societies\n'); INSERT INTO `default_table` VALUES (1861, 'City of Bay Village Animal Shelter', '31300 Naigle Road', 'Bay Village', 'OH', '44140', '(440) 835-3614', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1862, 'Humane Society Inc', '2521 US Highway 68 South', 'Bellefontaine', 'OH', '43311', '(937) 593-4277', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1863, 'Berea Animal Rescue Fund', '390 Barrett Road', 'Berea', 'OH', '44017', '(440) 234-2034', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1864, 'Harlequin Haven Great Dane Rescue', '11567 State Route 774', 'Bethel', 'OH', '45106', '(937) 379-2231', 'http://great-dane-rescue.org', 'info@hhdane.com', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1865, 'Humane Society of Wood County', '801 Van Camp Road', 'Bowling Green', 'OH', '43402', '(419) 352-7339', 'http://www.woodcountyhumanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1866, 'Williams County - Humane Society', '9464 County Road 13', 'Bryan', 'OH', '43506', '(419) 636-2200', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1867, 'Andrews Hall', '4750 State Route 165', 'Canfield', 'OH', '44406', '(330) 549-1111', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nMeetings, New Fully Equipped Facility, Proceeds To Angels For Animals\n'); INSERT INTO `default_table` VALUES (1868, 'Angels for Animals Inc', '4750 State Route 165', 'Canfield', 'OH', '44406', '(330) 549-1111', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDog & Cat Adoptions, Neuter & Spay, Information Available\n'); INSERT INTO `default_table` VALUES (1869, 'Humane Society Of Stark County Animal Shelter', '5100 Peach Street Northeast', 'Canton', 'OH', '44702', '(330) 453-5529', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1870, 'Dog Pounds - Hamilton County SPCA', '3949 Colerain Avenue', 'Cincinnati', 'OH', '45223', '(513) 541-6100', 'http://www.spcacincinnati.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1871, 'Scratching Post', '6958 Plainfield Road', 'Cincinnati', 'OH', '45236', '(513) 984-6369', 'http://www.thescratchingpost.org', 'info@thescratchingpost.org', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1872, 'Ohio Graphic Arts Welfare Fund', '11 Triangle Drive', 'Cincinnati', 'OH', '45241', '(513) 771-5426', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1873, 'Ferrets Unlimited Ferret Shelter', '4116 Bucyrus Avenue', 'Cleveland', 'OH', '44109', '(216) 749-3885', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1874, 'Pet Shelter of Northeast Ohio S P C A Inc', '9555 Brookpark Road', 'Cleveland', 'OH', '44129', '(216) 351-7387', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nNo Kill Pet Shelter, Pet Adoptions: Dogs Puppies Kittens & Cats, Take-in by Appointment Only, Open for Adoptions\n'); INSERT INTO `default_table` VALUES (1875, 'City of Parma-Service Garage', '5680 Chevrolet Boulevard', 'Cleveland', 'OH', '44130', '(440) 885-8014', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1876, 'Bide-A-Wee Cat Shelter', '8800 Akins Road', 'Cleveland', 'OH', '44133', '(440) 582-4990', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1877, 'Parma Animal Shelter', '6260 State Road', 'Cleveland', 'OH', '44134', '(440) 885-8014', 'http://www.parmashelter.org', 'PAS@CORE.COM', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1878, 'Cuyahoga County - Animal Shelter, Volunteers For Animals Ccva', '9500 Sweet Valley Drive', 'Cleveland', 'OH', '44125', '(216) 525-4817', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1879, 'Cuyahoga County - Animal Shelter', '9500 Sweet Valley Drive', 'Cleveland', 'OH', '44125', '(216) 525-7877', 'http://www.cuyahoga.oh.us', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1880, 'Cat Welfare Association Inc', '741 Wetmore Road', 'Columbus', 'OH', '43214', '(614) 268-6096', 'http://www.catwelfareohio.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1881, 'Pets Without Parents', '629 Oakland Park Avenue', 'Columbus', 'OH', '43214', '(614) 267-7297', 'http://www.petswithoutparents.net', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAdoption, No Kill-Non-Profit Animal Shelter\n'); INSERT INTO `default_table` VALUES (1882, 'Youth To Youth Ministries Mission House', '803 Kelton Avenue', 'Columbus', 'OH', '43205', '(614) 258-8190', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1883, 'Franklin County - All Other Calls, Dog Warden Department, Dog License Department, Stray Dogs', '1721 Alum Creek Drive', 'Columbus', 'OH', '43207', '(614) 462-3400', 'http://www.franklincountydogs.com', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDREHEL''S SMALL ENGINE, PRESSURE WASHERS (GENERAC, HONDA ENGINES, WARRANTY WORK, MTD-TECUMSEH-MURRAY, BRIGGS & STRATTON-GENERAC\n'); INSERT INTO `default_table` VALUES (1884, 'Murphys Homeless Shelter', '1635 Alona Drive', 'Columbus', 'OH', '43224', '(614) 268-2371', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1885, 'Franklin County - Dog License Department, Lost Dogs', '173 Alum Creek Drive', 'Columbus', 'OH', '43201', '(614) 462-4360', 'http://www.franklincountydogs.com', '', '', 'Open 7 Days A Week,mon-Fri 11Am-7Pm,sat-Sun 9Am-5Pm', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1886, 'Pet Guards Shelter', '950 Hardy Road', 'Cuyahoga Falls', 'OH', '44223', '(330) 849-0634', 'http://www.petguards.com', '', '', 'Tuesday-Friday 12:00Pm-7:00Pm,saturday 10:00Am-4:00Pm,closed Sunday-Monday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nCats And Dogs, All Pets Spayed & Neutered\n'); INSERT INTO `default_table` VALUES (1887, 'Oakwood Used Furniture', '3265 Oakwood Drive', 'Cuyahoga Falls', 'OH', '44221', '(330) 920-1522', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1888, 'Animal Resource Center Of Montgomery County', '6790 Webster Street', 'Dayton', 'OH', '45414', '(937) 898-4457', 'http://www.mcohio.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSheltering Of Stray And Unwanted Dogs, Canine Cruelty Investigations, Pet Lost/Found Information Center, Dog/Cat Adoption Services, Private Cremation Services Available, Humane Education Programs,... (Show More)\nSheltering Of Stray And Unwanted Dogs, Canine Cruelty Investigations, Pet Lost/Found Information Center, Dog/Cat Adoption Services, Private Cremation Services Available, Humane Education Programs, Speakers Bureau, Volunteer Opportunities, Pet Behavior Information, Bark Park  (Show Less)\n'); INSERT INTO `default_table` VALUES (1889, 'Humane Society Of Greater Dayton', '1661 Nicholas Road', 'Dayton', 'OH', '45418', '(937) 268-7387', 'http://www.humanesocietydayton.org', '', '', '11 Am To 6 Pm Tuesday Through Friday 9:30 Am To 4:00 Pm Saturday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nFinding Great Homes For Great Pets, Pet Adoptions, Education Programs, Community Outreach Programs, Volunteer Opportunities, Spay & Neuter Programs, Cruelty & Neglect Investigations, Fundraising... (Show More)\nFinding Great Homes For Great Pets, Pet Adoptions, Education Programs, Community Outreach Programs, Volunteer Opportunities, Spay & Neuter Programs, Cruelty & Neglect Investigations, Fundraising Activities  (Show Less)\n'); INSERT INTO `default_table` VALUES (1890, 'Sicsa Pet Adoption Center', '2600 Wilmington Pike', 'Dayton', 'OH', '45419', '(937) 294-6505', 'http://www.sicsa.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nSomeone Here Needs You, Dog & Cat Adoptions, Volunteer Opportunities, Pet Facilitated Therapy, Dog Training, Lost / Found Information Center, Bringing Loving Hearts Together\n'); INSERT INTO `default_table` VALUES (1891, 'Humane Society of Del CTY & Spay Neuter Clinic', '4920 State Route 37 East', 'Delaware', 'OH', '43015', '(740) 369-7387', 'http://www.delawarecohumanesoc.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1892, 'Cats N US', '829 Union Avenue', 'Dover', 'OH', '44622', '(330) 602-6762', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1893, 'Animal Protective League Of Lorain County', '7202 Murray Ridge Road', 'Elyria', 'OH', '44035', '(440) 322-4321', 'http://www.animalprotectiveleague.org', '', '', 'Evening-Weekend Available', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nObedience Training For Dogs Why Pay More, Professional Obedience Training, Positive Reinforcement, Private & Group Instruction In - Home Training, Economical Prices, Flexible Hours Evening &... (Show More)\nObedience Training For Dogs Why Pay More, Professional Obedience Training, Positive Reinforcement, Private & Group Instruction In - Home Training, Economical Prices, Flexible Hours Evening & Weekends Available  (Show Less)\n'); INSERT INTO `default_table` VALUES (1894, 'Gallia County - Animal Shelter', '186 Shawnee Lane', 'Gallipolis', 'OH', '45631', '(740) 441-0207', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1895, 'Brown County Humane Society', '604 South Main Street', 'Georgetown', 'OH', '45121', '(937) 378-2210', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1896, 'Brown County - Animal Shelter, Dog Warden', '100 Veterans Boulevard', 'Georgetown', 'OH', '45121', '(937) 378-3457', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1897, 'Darke County - Animal Shelter', '5066 County Home Road', 'Greenville', 'OH', '45331', '(937) 547-1645', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1898, 'Butler County - Animal Friends Humane Society, Humane Association Of Butler County', '5225 Hamltntrenton Road', 'Hamilton', 'OH', '45011', '(513) 867-5727', 'http://www.animalfriendshs.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1899, 'Healthy Pets of Rome', '2194 Hilliard Rome Road', 'Hilliard', 'OH', '43026', '(614) 777-2018', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1900, 'Healthy Pets Of Rome-Hilliard Inc', '2194 Hilliard Rome Road', 'Hilliard', 'OH', '43026', '(614) 876-8986', 'http://www.healthypetsofohio.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1901, 'Capital Area Humane Society', '3015 Scioto Darby Executi', 'Hilliard', 'OH', '43026', '(614) 777-7387', 'http://www.cahs-pets.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1902, 'Highland County Humane Society - Animal Shelter', '9331 State Route 124', 'Hillsboro', 'OH', '45133', '(937) 393-2110', 'http://www.hc-humanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1903, 'Highland County - Animal Shelter, Dog Warden', '9353 State Route 124', 'Hillsboro', 'OH', '45133', '(937) 393-8191', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1904, 'K-9''S for Compassion', '736 North Main Street', 'Hubbard', 'OH', '44425', '(330) 534-2001', 'http://www.k9sforcompassion.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1905, 'Fairfield County Emergency Shelter', '1582 E Main Street', 'Lancaster', 'OH', '43130', '(740) 654-3632', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1906, 'Warren County Of Lebanon - Animal Shelter', '230 Cook Road', 'Lebanon', 'OH', '45036', '(513) 695-1352', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1907, 'Hagars House', '2620 Stonywood Drive', 'Lima', 'OH', '45801', '(419) 228-4242', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1908, 'Angels For Animal Rescue League', '115 West Kiracofe Avenue', 'Lima', 'OH', '45807', '(419) 339-9408', '', '', '', '', '\nAdditional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1909, 'Humane Society', '1357 State Route 38 Southeast', 'London', 'OH', '43140', '(740) 852-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1910, 'Stop the Overpopulation of Pets', '1152 Lexington Avenue', 'Mansfield', 'OH', '44907', '(419) 774-1738', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1911, 'Marion Area Humane Society', '2264 Richland Road', 'Marion', 'OH', '43302', '(740) 389-6548', '', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Additional Information:
\nNon-Profit Organization\n'); INSERT INTO `default_table` VALUES (1912, 'Humane Society', '1920 Indian Wood Circle', 'Maumee', 'OH', '43537', '(419) 891-0705', 'http://www.toledoareahumanesociety.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDogs / Cats, Puppies / Kittens, Adoption Fee Includes Health Exam Initial Shots Spay/Neuter Heartworm Or Feline Leukemia Test Treated For Internal & External Parasites, For Off-Site Adoption Locations\n'); INSERT INTO `default_table` VALUES (1913, 'Forgotten Animal Shelter Inc', '23 Public Square', 'Medina', 'OH', '44256', '(330) 723-9918', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1914, 'Lake County Humane Society', '7564 Tyler Boulevard', 'Mentor', 'OH', '44060', '(440) 951-6122', '', '', 'Animal Adoption Shelter Procedures', 'Mon 10:00am-07:00pm
Tue-Wed: 10:00am-06:00pm
Thu 10:00am-07:00pm
Fri 10:00am-05:00pm
Sat', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\n24 Hour, 365 Days A Year Animal Rescue\n'); INSERT INTO `default_table` VALUES (1915, 'Warren County Of Franklin - Animal Shelter', '230 Cook Road', 'Middletown', 'OH', '45042', '(513) 261-1352', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1916, 'Lovejoy''s Halfway Housewildlife Rehabilitation Center', '5111 County Road South', 'Montpelier', 'OH', '43543', '(419) 459-4640', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1917, 'Henry County Humane Society', '1136 Industrial Drive', 'Napoleon', 'OH', '43545', '(419) 592-3777', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1918, 'Stay-A-While Cat Shelter', '8800 Akins Road', 'North Royalton', 'OH', '44133', '(440) 582-4990', 'http://www.stayawhilecatshelter.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1919, 'Huron County Humane Society', '246 Woodlawn Avenue', 'Norwalk', 'OH', '44857', '(419) 663-7158', 'http://www.hc-humanesociety.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1920, 'Rescue Village Geauga Humane Society', '15463 Chillicothe Road', 'Novelty', 'OH', '44072', '(440) 338-4819', 'http://www.geaugahumane.org', '', '', '6 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nOPEN: MON & THURS 12-7 PM TUES FRI SAT SUN 12-5PM CLOSED WEDS\n'); INSERT INTO `default_table` VALUES (1921, 'Humane Society of Greater Akron', '4904 Quick Road', 'Peninsula', 'OH', '44264', '(330) 657-2010', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPuppies Kittens Dogs Cats, Cruelty Investigation\n'); INSERT INTO `default_table` VALUES (1922, 'Cozy Cat Cottage Adoption Center', '62 Village Pointe Drive', 'Powell', 'OH', '43065', '(614) 336-8510', 'http://www.cozycatcottage.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1923, 'Cozy Cat Cottage Boutique', '240 N Liberty Street', 'Powell', 'OH', '43065', '(614) 846-3809', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1924, 'Animal Protective League of Portage CO', '8122 Infirmary Road', 'Ravenna', 'OH', '44266', '(330) 296-4022', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1925, 'Humane Society of Erie County', '1911 Superior Street', 'Sandusky', 'OH', '44870', '(419) 626-6220', 'http://www.humanesocietyoferiecounty.org', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\n(And Occasionally Other Adoptable Pets), Low Income Spay & Neuter, Certificate Available\n'); INSERT INTO `default_table` VALUES (1926, 'Shelby County - Department Listings-Please Direct Animal Shelter', '1100 Clem Road', 'Sidney', 'OH', '45365', '(937) 498-7201', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1927, 'Animal Care Center of Tiffin', '1790 West County Road 54', 'Tiffin', 'OH', '44883', '(419) 455-7387', '', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSmall Animal Medicine & Surgery\n'); INSERT INTO `default_table` VALUES (1928, 'Hagen Mark DVM', '1790 West County Road 54', 'Tiffin', 'OH', '44883', '(419) 455-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1929, 'Toledo Animal Shelter Association', '640 Wyman Street', 'Toledo', 'OH', '43609', '(419) 382-1130', 'http://www.toledoanimalshelter.com', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nA Non-Profit No Kill Facility, We Accept, Homeless & Abused Animals, Adoption Includes Exam Heartworm Leukemia Test Initial Shots Spay/Neuter Parasite Treatment, We Sell Dog Licenses\n'); INSERT INTO `default_table` VALUES (1930, 'Paws and Whiskers Cat Shelter Inc', '38 Hillwyck Drive', 'Toledo', 'OH', '43615', '(419) 536-1914', 'http://www.pawsandwhiskers.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nGive Yourself A Feline Friend\n'); INSERT INTO `default_table` VALUES (1931, 'Litter Flush', '39 West Alexis Road PMB 101', 'Toledo', 'OH', '43612', '(330) 544-9878', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1932, 'Toledo Area Humane Society', '1920 Indianwood Circle', 'Toledo', 'OH', '43601', '(419) 891-0705', 'http://www.toledoareahumanesociety.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDogs / Cats, Puppies / Kittens, Adoption Fee Includes Health Exam Initial Shots Spay/Neuter Heartworm Or Feline Leukemia Test Treated For Internal & External Parasites, For Off-Site Adoption Locations\n'); INSERT INTO `default_table` VALUES (1933, 'Oct Health & Welfare Fund', '435 South Hawley Street', 'Toledo', 'OH', '43609', '(419) 241-7879', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1934, 'Animal Friends Humane Society', '5225 Trenton Road', 'Trenton', 'OH', '45067', '(513) 867-5727', 'http://www.butlercountyohio.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1935, 'Humane Association of Butler County', '5225 Trenton Road', 'Trenton', 'OH', '45067', '(513) 867-5727', 'http://www.butlercountyohio.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1936, 'Cat''s N Us', '128 N Uhrich Street', 'Uhrichsville', 'OH', '44683', '(740) 922-7575', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1937, 'Animal Medical Center', '9640 County Highway 330', 'Upper Sandusky', 'OH', '43351', '(419) 294-4477', 'http://www.wyhumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1938, 'Wyandot County Humane Society', '9640 County Highway 330', 'Upper Sandusky', 'OH', '43351', '(419) 294-4477', 'http://www.wyhumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1939, 'Paws Animal Shelter', '1535 West US Highway 36', 'Urbana', 'OH', '43078', '(937) 653-6233', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1940, 'Champaign Co Humane Association Inc', '1535 W Route 36', 'Urbana', 'OH', '43078', '(937) 653-6233', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1941, 'Humane Society Of Auglaize Co', '733 Keller Drive', 'Wapakoneta', 'OH', '45895', '(419) 738-3647', 'http://www.achs-pets.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1942, 'Humane Society of Auglaize CO', '733 Keller Drive', 'Wapakoneta', 'OH', '45895', '(419) 738-7808', 'http://www.achs-pets.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1943, 'Animal Welfare League Of Trumbull County', '545 Brunstetter Road Southwest', 'Warren', 'OH', '44481', '(330) 394-4122', '', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (1944, 'Animal Welfare League Shelter - Shelter', '545 Brunstetter Road Southwest', 'Warren', 'OH', '44481', '(330) 394-4122', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1945, 'Animal Welfare League Shelter Humane', '545 Southwest Brunstetter Road', 'Warren', 'OH', '44481', '(330) 399-2086', '', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (1946, 'Golden Retriever Rescue Resource', '739 Weather Stone', 'Wauseon', 'OH', '43567', '(419) 822-5872', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1947, 'Humane Society Of Greene County', '765 North Detroit Street', 'Xenia', 'OH', '45385', '(937) 376-3001', 'http://www.humanesocietygreenecounty.com', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (1948, 'Lutz William DVM', '3722 South Avenue', 'Youngstown', 'OH', '44502', '(330) 783-0645', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1949, 'Animal Charity', '3722 South Avenue', 'Youngstown', 'OH', '44502', '(330) 783-0645', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\n~Love The Earth & All Its Creatures~, Report Abuse & Neglect, All Reports Kept Confidential, Educational Programs Available, Wildlife Rehabilitation & Release\n'); INSERT INTO `default_table` VALUES (1950, 'Animal Shelter Society', '1431 Serenity Lane', 'Zanesville', 'OH', '43701', '(740) 452-1077', 'http://www.assi.proboards2.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1951, 'Pontotoc Animal Welfare Society Shelter', '1200 Sandy Creek Drive', 'Ada', 'OK', '74820', '(580) 332-5233', '', '', '', 'M-F 10-4 Sat 10-2 Clsd Sun-Holidays', '\nProducts & Services:
\n\n
Additional Information:
\nCity Government-Social & Human Resources\n'); INSERT INTO `default_table` VALUES (1952, 'Altus City - Animal Shelter', '2200 Enterprise Drive', 'Altus', 'OK', '73521', '(580) 481-2285', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1953, 'Ardmore Animal Care Inc', '321 Carol Brown Boulevard', 'Ardmore', 'OK', '73401', '(580) 223-7070', 'http://www.ardmoreanimalshelter.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelter & Education Center, Save A Life! Adopt A Pet!, AAS\n'); INSERT INTO `default_table` VALUES (1954, 'Spca Animal Shelter', '16620 State Highway 123', 'Bartlesville', 'OK', '74006', '(918) 336-1577', 'http://www.wcspca.org', '', '', 'Tuesday-Friday 10:00Am-6:00Pm,saturday 10:00Am-4:00Pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdoption - Pets - Crematory Service, Call Police Dept To Pick-Up Stray Animals\n'); INSERT INTO `default_table` VALUES (1955, 'Animal Rescue Foundation of Bartlesville', '127 Northeast Washington Boulevard', 'Bartlesville', 'OK', '74006', '(918) 766-0991', 'http://www.arfok.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1956, 'Bristow Animal Shelter', '110 West 7th Avenue', 'Bristow', 'OK', '74010', '(918) 367-2237', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nHumane Societies, Veterinarians Exchanges\n'); INSERT INTO `default_table` VALUES (1957, 'Elk City City - Animal Shelter', '1022 South Main Street', 'Elk City', 'OK', '73644', '(580) 225-7222', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1958, 'Lawton Animal League', '2104 Southwest 6th Street', 'Lawton', 'OK', '73501', '(580) 581-3218', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nGovernment Offices-City, Village & Township\n'); INSERT INTO `default_table` VALUES (1959, 'Muskogee City - Police Department', '911 Addresses', 'Muskogee', 'OK', '74401', '(918) 680-3144', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1960, 'Muskogee-City - Animal Shelter, Municipal Court Clerk, Police Department', '112 South 3rd Street', 'Muskogee', 'OK', '74401', '(918) 682-3371', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1961, 'Muskogee-City - Animal Shelter, Detectives, Police Department', '112 South 3rd Street', 'Muskogee', 'OK', '74401', '(918) 682-4161', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1962, 'Norman-City - Animal Shelter', '3428 Jenkins Avenue', 'Norman', 'OK', '73072', '(405) 292-9736', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1963, 'Second Chance Animal Sanctuary Inc', '4500 24th Northwest', 'Norman', 'OK', '73069', '(405) 321-1915', 'http://www.secondchanceok.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1964, 'Oklahoma City-City - Animal Welfare, Animal Shelter', '2811 Southeast 29th Street', 'Oklahoma City', 'OK', '73102', '(405) 297-3100', 'http://www.okc.gov', '', '', 'Tues-Sat Noon-5:45 Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1965, 'Feeding The Broken Hearted', '4125 NW 30th Street', 'Oklahoma City', 'OK', '73112', '(405) 917-5088', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1966, 'Feeding The Broken Hearted', '1218 NW 30th Street', 'Oklahoma City', 'OK', '73118', '(405) 524-1944', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1967, 'Okmulgee City - Animal Shelter', '1239 North Okmulgee Avenue', 'Okmulgee', 'OK', '74447', '(918) 758-1125', 'http://www.okmulgee.petfinder.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1968, 'Pauls Valley City - Police', '215 North Walnut Street', 'Pauls Valley', 'OK', '73075', '(405) 238-5531', '', '', '', 'Mon-Fri/Weekdays', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1969, 'Ponca City Humane Society', '900 West Prospect Avenue', 'Ponca City', 'OK', '74601', '(580) 767-8877', 'http://www.pchumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1970, 'Animal Shelter Sapulpa', '515 East Fife Avenue', 'Sapulpa', 'OK', '74066', '(918) 227-2722', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (1971, 'Shawnee-City - Animal Shelter', '1900 West Independence', 'Shawnee', 'OK', '74801', '(405) 878-1531', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1972, 'Tulsa City - Animal Shelter', '3031 North Erie Avenue', 'Tulsa', 'OK', '74115', '(918) 669-6280', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1973, 'Linn County Dog Control Licenses & Animal Shelter', '3008 Ferry Street Southwest', 'Albany', 'OR', '97322', '(541) 967-3925', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1974, 'Humane Society of Central Oregon', '61170 27th Street', 'Bend', 'OR', '97702', '(541) 382-3537', 'http://www.hsco.org', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nMaking Friends For Life, Dogs Cats & Other Critters\n'); INSERT INTO `default_table` VALUES (1975, 'South Coast Humane Society Shelter - Thrift Shop', '620 Hemlock', 'Brookings', 'OR', '97415', '(541) 469-5694', 'http://www.southcoasthumane.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1976, 'Humane Society of Harney County', '65353 Highway 78', 'Burns', 'OR', '97720', '(541) 493-9659', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1977, 'Greenhill Humane Society', '88530 Green Hill Road', 'Eugene', 'OR', '97402', '(541) 689-1503', 'http://www.green-hill.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nSave A Life - Adopt A Pet, Rabbits & Small Animals, Pet Supplies And Food, End Of Life Services\n'); INSERT INTO `default_table` VALUES (1978, 'Save A Life-Adopt A Pet', '88530 Green Hill Road', 'Eugene', 'OR', '97402', '(541) 689-1503', '', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nGreenhill Humane Society, Rabbits & Small Animals, Pet Supplies And Food, End Of Life Services\n'); INSERT INTO `default_table` VALUES (1979, 'Wildlife Images Inc', '11845 Lower River Road', 'Grants Pass', 'OR', '97526', '(541) 476-0222', 'http://www.wildlifeimages.org', '', '', '', '\nAdditional Information:
\nNon-Profit Organizations\n'); INSERT INTO `default_table` VALUES (1980, 'Pet Rescue-Humane Society Of Eastern Or', '1844 Northwest Geer Road', 'Hermiston', 'OR', '97838', '(541) 564-6222', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1981, 'Homestead Boarding Kennel', '1850 NW Geer Road', 'Hermiston', 'OR', '97838', '(541) 567-5478', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1982, 'Blue Mountain Humane Associates', '3212 Highway 30', 'La Grande', 'OR', '97850', '(541) 963-0807', 'http://www.bmhumane.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nCrematorium, Educational Services Available\n'); INSERT INTO `default_table` VALUES (1983, 'Jefferson County - Animal Shelter', '1694 Southeast McTaggart Road', 'Madras', 'OR', '97741', '(541) 475-6889', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1984, 'Humane Society Of Southern Oregon', '2910 Table Rock Road', 'Medford', 'OR', '97501', '(541) 779-3215', 'http://www.southernoregonhumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1985, 'Committed Alliance To Strays Cats', '104 North Ross Lane', 'Medford', 'OR', '97501', '(541) 779-2916', 'http://www.kittensandcats.org', '', '', 'Open Tues-Sat 12-6', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdoptable Cats, Tested, Vaccinated, Sprayed/Neutered\n'); INSERT INTO `default_table` VALUES (1986, 'Lincoln County - Animal Shelter', '510 Northeast Harney Street', 'Newport', 'OR', '97365', '(541) 265-6610', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1987, 'Central Coast Humane Society', '510 Northeast Harney Street', 'Newport', 'OR', '97365', '(541) 265-3719', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1988, 'Jackson County - Animal Control, Animal Care & Control Center', '5595 South Pacific Highway', 'Phoenix', 'OR', '97535', '(541) 774-6654', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1989, 'Family Dogs New Life Shelter', '9101 Southeast Stanley Avenue', 'Portland', 'OR', '97206', '(503) 771-5596', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nwww.familydogsnewlife.org\n'); INSERT INTO `default_table` VALUES (1990, 'Mepihn', '12727 SE Market Street', 'Portland', 'OR', '97233', '(503) 256-2280', '', '', '', '', ''); INSERT INTO `default_table` VALUES (1991, 'Animal Aid', '5335 Southwest 42nd Avenue', 'Portland', 'OR', '97221', '(503) 292-6628', 'http://www.animalaid.info', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1992, 'Saving Grace Pet Adoption Center', '943 Del Rio Road', 'Roseburg', 'OR', '97470', '(541) 672-3907', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1993, 'Douglas - If Unable To Locate Desired Number Below Call Dougl, Animal Shelter', '943 Del Rio Road', 'Roseburg', 'OR', '97470', '(541) 672-3907', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1994, 'Cat Adoption Team', '14175 Southwest Galbreath Drive', 'Sherwood', 'OR', '97140', '(503) 925-8903', 'http://www.catadoptionteam.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1995, 'Last Chance', '865 West Central', 'Sutherlin', 'OR', '97479', '(541) 459-5335', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1996, 'Pet Adoptions Westside', '1741 Willamette Falls Drive', 'West Linn', 'OR', '97068', '(503) 650-0855', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1997, 'Paws Animal Shelter', '1741 Willamette Falls', 'West Linn', 'OR', '97068', '(503) 650-0855', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1998, 'Spca Of Montgomery County', '1006 Edge Hill Road', 'Abington', 'PA', '19001', '(215) 886-8802', 'http://www.montgomerycountyspca.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (1999, 'Humane Society of Lehigh County', '640 Dixon Street', 'Allentown', 'PA', '18103', '(610) 797-1205', 'http://www.lehighcounty.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Additional Information:
\nHave You: Lost Your Pet? Found A Stray?, Decided To Adopt A Pet? Seen Animal Abuse?\n'); INSERT INTO `default_table` VALUES (2000, 'Women''s Humane Society - Shelter', '3839 Richlieu Road', 'Bensalem', 'PA', '19020', '(215) 750-3100', '', '', '', 'Mon-Fri: 08:00am-05:00pm', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n'); INSERT INTO `default_table` VALUES (2001, 'Animal Rescue League Of Berks County', '58 Kennel Road', 'Birdsboro', 'PA', '19601', '(610) 373-8830', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2002, 'Kitty Cottage Adoption Center Inc', '1536 Dekalb Pike', 'Blue Bell', 'PA', '19422', '(610) 731-0101', 'http://www.kittycottage.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2003, 'McKean County S P C A', '80 Glenwood Avenue', 'Bradford', 'PA', '16701', '(814) 362-8850', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2004, 'Pet Adoption Center', '705 South Spring Garden Street', 'Carlisle', 'PA', '17013', '(717) 258-1817', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2005, 'Penna Society For The Prevention Of Cruelty To Animals', '2451 General Potter Highway', 'Centre Hall', 'PA', '16828', '(814) 364-1725', '', '', '', 'Monday-Tuesday-Friday-Saturday 10:00Am-3:00Pm,thursday 10:00Am-6:00Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2006, 'SPCA', '2451 General Potter Highway', 'Centre Hall', 'PA', '16828', '(814) 364-1725', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2007, 'Penna Society For The Prevention Of Cruelty To Animals', '2451 General Potter Highway', 'Centre Hall', 'PA', '16828', '(814) 634-1725', '', '', '', 'Monday-Tuesday-Friday-Saturday 10:00Am-3:00Pm,thursday 10:00Am-6:00Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2008, 'Cumberland Valley Animal Shelter Thrift Store', '66 South Main Street', 'Chambersburg', 'PA', '17201', '(717) 261-1996', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2009, 'Greener Pastures Pet Cemetery', '967 Griffin Pond Road', 'Clarks Summit', 'PA', '18411', '(570) 586-3700', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2010, 'Humane Society Of Lackawanna County', '967 Griffin Pond Road', 'Clarks Summit', 'PA', '18411', '(570) 586-3700', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2011, 'Spca Of Montgomery County', '19 East Ridge Pike', 'Conshohocken', 'PA', '19428', '(610) 825-0111', 'http://www.montgomerycountyspca.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2012, 'Animals in Distress', '5075 Limeport Pike', 'Coopersburg', 'PA', '18036', '(610) 966-9383', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2013, 'S P C A Penna', '2801 Bloom Road', 'Danville', 'PA', '17821', '(570) 275-0340', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2014, 'Animal Friends', '126 Harvey Avenue', 'Doylestown', 'PA', '18901', '(215) 345-0565', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2015, 'Fallen Timber Animal Shelter', '1680 Fallen Timber Road', 'Elizabeth', 'PA', '15037', '(412) 751-2010', 'http://wpahumane.org', '', '', 'Monday Through Friday 10:00 To 7:00 Saturday And Sunday 10-5', '\nProducts & Services:
\n\n
Additional Information:
\nOpen 7 Days A Week, Spay & Neuter Service, Obedience Training Classes, 1101 Western Av 412 321-4625\n'); INSERT INTO `default_table` VALUES (2016, 'Weather Lock Construction Inc', '350 Dora Drive', 'Elizabeth', 'PA', '15037', '(412) 672-1003', '', '', 'Western PA''s Lowest Window Prices', 'Open 24 Hours/7 Days', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\n* WORK COMPLETED IN ONE DAY, Casement, Circle Top\n'); INSERT INTO `default_table` VALUES (2017, 'Western Pennsylvania Humane Society - Kennels, Pet Cemetery', '1680 Fallen Timber Road', 'Elizabeth', 'PA', '15037', '(412) 751-2010', 'http://wpahumane.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nOpen 7 Days A Week, Spay & Neuter Service, Obedience Training Classes, 1101 Western Av 412 321-4625\n'); INSERT INTO `default_table` VALUES (2018, 'Western Pa Humane Society', '1680 Fallen Timber Road', 'Elizabeth', 'PA', '15037', '(412) 751-2010', 'http://wpahumane.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nOpen 7 DAYS A Week, Spray & Neuter Service Obedience Training Classes, 1101 Western Ave. 412 321-4625\n'); INSERT INTO `default_table` VALUES (2019, 'Anna Shelter', '1555 East 10th', 'Erie', 'PA', '16511', '(814) 451-0230', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2020, 'Pet Finders', '864 Newton Avenue', 'Erie', 'PA', '16511', '(814) 899-5812', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2021, 'Forgotten Felines and Fidos Inc', '6022 Mountain Road', 'Germansville', 'PA', '18053', '(610) 760-9009', '', 'jojo@forgottenfelines.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2022, 'Adams County S P C A', '11 Goldenville Road', 'Gettysburg', 'PA', '17325', '(717) 334-8876', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2023, 'The Rabbit Habit', '638 Robert Avenue', 'Glenside', 'PA', '19038', '(215) 517-7067', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2024, 'Strayhaven Inc', '94 Donation Road', 'Greenville', 'PA', '16125', '(724) 588-6161', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2025, 'Lost & Found Horse Rescue', '1030 Maclay', 'Harrisburg', 'PA', '17103', '(717) 234-4206', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2026, 'Hazleton Animal Shelter', '101 North Poplar Street', 'Hazleton', 'PA', '18201', '(570) 454-0640', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2027, 'Four Footed Friends', '228 Beck Road', 'Indiana', 'PA', '15701', '(724) 349-1144', 'http://www.fourfootedfriends.org', 'jesi@helicon.net', 'Your Animal Shelter Since 1982', 'M-F 8am-4pm', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2028, 'Animal Shelter', '743 Galleria Drive Extension', 'Johnstown', 'PA', '15904', '(814) 535-6116', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2029, 'Humane Society of Cambria County', '743 Galleria Drive Extension', 'Johnstown', 'PA', '15904', '(814) 535-6116', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2030, 'Orphans Of The Storm Inc Armstrong County Animal Shelter', '111878 State Route 83', 'Kittanning', 'PA', '16201', '(724) 548-4520', '', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (2031, 'Operation Scarlet Inc', '520 South Queen Street', 'Lancaster', 'PA', '17603', '(717) 397-6362', 'http://www.operationscarlet.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2032, 'Humane League Of Lancaster County', '2195 Lincoln Highway East', 'Lancaster', 'PA', '17602', '(717) 393-6551', 'http://www.humaneleague.com', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (2033, 'Action for Animals Inc', '125 Farview Lane', 'Latrobe', 'PA', '15650', '(724) 539-2544', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2034, 'Four Paws Inc', '3501 Bristol Oxford Valle Apt 890', 'Levittown', 'PA', '19057', '(215) 428-4701', 'http://www.fourpawsdoggiedaycare.com', '', '', '', '\nSpecialties:
\n\n
Additional Information:
\nDay & Overnight Care Grooming Training Dog Food & Supplies, Pick-Up & Delivery Available\n'); INSERT INTO `default_table` VALUES (2035, 'Appalachian Horse Rescue', '1201 Yergers Road', 'Linden', 'PA', '17744', '(570) 323-1266', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2036, 'Pretty Pets by BEV', '2933 Jacks Run Road', 'Mckeesport', 'PA', '15131', '(412) 673-0411', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2037, 'White Oak Animal Safe Haven', '2295 Lincoln Way', 'Mckeesport', 'PA', '15131', '(412) 672-8901', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2038, 'Crawford County Humane Society', '11012 Kennedy Hill Road', 'Meadville', 'PA', '16335', '(814) 724-5115', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2039, 'Lucky Pups Rescue', '122 Bald Hill Church Road', 'Mount Morris', 'PA', '15349', '(724) 324-2226', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2040, 'Animal Angels', '419 Three Mile Hill', 'Mount Pleasant', 'PA', '15666', '(724) 542-9242', 'http://www.animalangelsrescue.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2041, 'Animal Coalition of Delaware County, Inc.', '3553 West Chester Pike #144', 'Newtown Square', 'PA', '19073', '(610) 876-1479', 'http://www.acdc.ws', 'info@acdc.ws', '', '', '\nPayment Options:
\n\n'); INSERT INTO `default_table` VALUES (2042, 'Soles Vicky L DVM', '453 Ned Ridge Road', 'New Freeport', 'PA', '15352', '(724) 447-2316', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2043, 'Animal Protectors of Allegheny Valley', '533 Linden Avenue', 'New Kensington', 'PA', '15068', '(724) 339-7388', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2044, 'Spca Of Montgomery County', '1055 Sweifford Road', 'Perkiomenvlle', 'PA', '18074', '(610) 489-7510', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2045, 'Pennsylvania Society For The Prevention Of Cruelty To Animals', '350 East Erie Avenue', 'Philadelphia', 'PA', '19134', '(215) 426-6300', 'http://www.pspca.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nRescue, Repair, Re-Home\n'); INSERT INTO `default_table` VALUES (2046, 'Last Chance', '216 South 52nd Street', 'Philadelphia', 'PA', '19139', '(215) 474-9663', '', '', '', '', '\nAdditional Information:
\nClothes & Accessories Consignment & Resale\n'); INSERT INTO `default_table` VALUES (2047, 'Morris Animal Refuge', '1242 Lombard Street', 'Philadelphia', 'PA', '19147', '(215) 735-3256', 'http://www.morrisanimalrefuge.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2048, 'Last Chance', '3234 Kensington', 'Philadelphia', 'PA', '19134', '(215) 425-8646', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2049, 'Animal Friends', '562 Camp Horne', 'Pittsburgh', 'PA', '15237', '(412) 847-7000', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2050, 'Triangle Pet Control Service Co Inc', '441 Robb Street', 'Pittsburgh', 'PA', '15203', '(412) 771-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2051, 'The Animal Rescue League of Western Pennsylvania', '6620 Hamilton Avenue', 'Pittsburgh', 'PA', '15206', '(412) 661-6452', 'http://www.animalrescue.org', '', '', '7 Days A Week', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (2052, 'Animal Rescue League of Western Pennsylvania Inc - OFC', '6620 Hamilton Avenue', 'Pittsburgh', 'PA', '15206', '(412) 661-6452', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2053, 'Animal Friends Inc', '777 Penn Street', 'Pittsburgh', 'PA', '15215', '(412) 829-1185', '', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2054, 'Animal Full Life Rescue Inc', '906 Ramsey Street', 'Pittsburgh', 'PA', '15221', '(412) 371-6734', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2055, 'Western Pa Humane Society', '1101 Western Avenue', 'Pittsburgh', 'PA', '15233', '(412) 321-4625', 'http://wpahumane.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSpay & Neuter Service, Pet Adoptions, Obedience Training Classes\n'); INSERT INTO `default_table` VALUES (2056, 'Mount Lebanon Animal Control', '1820 McLaughlin Run Road', 'Pittsburgh', 'PA', '15241', '(412) 831-7250', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2057, 'Far Point Animal Rescue', '1105 Red Hill Road', 'Port Trevortn', 'PA', '17864', '(570) 374-2648', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2058, 'Far Point Animal Rescue', '1507 Verdilla Road', 'Port Trevorton', 'PA', '17864', '(570) 374-2696', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2059, 'Godot Animal Sanctuary', '6300 State Route 36', 'Punxsutawney', 'PA', '15767', '(814) 938-7389', '', '', 'Operating Since 1994', 'M-Sat 8am-5pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2060, 'Last Chance Ranch', '9 Beck Road', 'Quakertown', 'PA', '18951', '(215) 538-2510', 'http://www.lastchanceranch.org', 'lori@lastchanceranch.org', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nRanches\n'); INSERT INTO `default_table` VALUES (2061, 'Humane Society of Berks County Inc', '1801 North 11th Street', 'Reading', 'PA', '19604', '(610) 921-2348', 'http://www.berkshumane.org', '', 'Pet Grooming', 'M-F 10am-4pm', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (2062, 'Susquehanna Stray Amimal Shelter', '87 Crest Hill Lane', 'Red Lion', 'PA', '17356', '(717) 244-9747', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2063, 'Mission Home Ministries Serenity House', '644 W Broadway', 'Red Lion', 'PA', '17356', '(717) 246-0388', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2064, 'Butler County Humane Society', '1015 Evans City Road', 'Renfrew', 'PA', '16053', '(724) 789-1150', 'http://www.bchs.petfinder.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2065, 'Scranton Animal Association Inc', '215 North 7th Avenue', 'Scranton', 'PA', '18503', '(570) 961-5800', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2066, 'Fayette Friends Of Animals', '223 Searights Herbert Road', 'Smock', 'PA', '15480', '(724) 245-7815', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2067, 'Humane Society Of Somerset County', '204 Whitetail Road', 'Somerset', 'PA', '15501', '(814) 443-2121', 'http://www.somersetpets.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2068, 'PAWS', '1042 Benner Pike', 'State College', 'PA', '16801', '(814) 237-8722', 'http://www.centrecountypaws.org', '', 'Personalized Care for Your Pets', 'M-Sun 11am-4pm', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (2069, 'Nittany Beagle Rescue', '3060 Sheffield Drive', 'State College', 'PA', '16801', '(814) 861-3904', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2070, 'Fayette S P C A', '215 Rankin Airshaft Road', 'Uniontown', 'PA', '15401', '(724) 438-3121', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (2071, 'Hope For The Animals', '1098 Washington Crossing Road', 'Upper Makefield', 'PA', '19067', '(215) 321-1798', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2072, 'Antietam Humane Society', '8513 Lyons Road', 'Waynesboro', 'PA', '17268', '(717) 762-9091', '', '', '', 'Open 10Am-4:30Pm,closed Wed-Sun', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2073, 'Pet Value International', '992 Old Eagle School Road', 'Wayne', 'PA', '19087', '(610) 293-0951', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2074, 'S P C A of Chester County', '1212 Phoenixville Pike', 'West Chester', 'PA', '19380', '(610) 692-6113', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2075, 'Shenango Valley Animal Shelter', '2599 Broadway Avenue', 'West Middlesex', 'PA', '16159', '(724) 342-5834', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2076, 'Peaceable Kingdom Inc', '1049 Macarthur Road', 'Whitehall', 'PA', '18052', '(610) 432-2532', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2077, 'Four Footed Friends', '220 Beck Road', 'White', 'PA', '15490', '(724) 349-0314', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2078, 'Lycoming County Spca', '2805 Reach Road', 'Williamsport', 'PA', '17701', '(570) 322-4646', 'http://www.lycoming.org/spca', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2079, 'Lost & Found Horse Rescue', '852 Valley Road', 'York', 'PA', '17403', '(717) 428-9701', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2080, 'York County S P C A', '1050 East King St', 'York', 'PA', '17404', '(717) 843-9186', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2081, 'Pet Adoption League', '152 Spring Street', 'Yukon', 'PA', '15698', '(724) 722-3670', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2082, 'Scituate Animal Shelter', '106 George Washington Hw', 'Clayville', 'RI', '02815', '(401) 647-7200', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2083, 'Pest Patrol Services', '1255 Oaklawn Avenue', 'Cranston', 'RI', '02920', '(401) 942-8318', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2084, 'Exeter Town - Animal Shelter', '169 South County Trail', 'Exeter', 'RI', '02822', '(401) 294-2754', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2085, 'Burrillville Town - Animal Shelter', '131 Clear River Drive', 'Harrisville', 'RI', '02830', '(401) 568-9480', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2086, 'Potter League For Animals', '87 Oliphant Lane', 'Middletown', 'RI', '02842', '(401) 846-8276', '', '', 'Pet Shop', 'Mon-Fri: 09:00am-05:00pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (2087, 'No Kingstown Exeter Animal Protection League Inc', '500 Stony Lane', 'North Kingstown', 'RI', '02852', '(401) 294-1115', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2088, 'Pet Refuge', '500 Stony Lane', 'North Kingstown', 'RI', '02852', '(401) 294-1115', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2089, 'Humane Association Of Northwestern Rhode Island Inc', '85 South Main Street', 'Pascoag', 'RI', '02859', '(401) 568-5734', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2090, 'Prov Animal Rescue League', '34 Elbow Street', 'Providence', 'RI', '02903', '(401) 421-1399', '', '', '', 'Open 7 Days A Week', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2091, 'Volunteer Services For Animals - Statewide Office', '27 Dryden Lane', 'Providence', 'RI', '02904', '(401) 273-0358', 'http://www.volunteerservicesforanimals.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2092, 'Volunteer Services For Animals - Providence Chapter Vsa', '7 Service Road', 'Providence', 'RI', '02905', '(401) 941-6830', 'http://www.volunteerservicesforanimals.org', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (2093, 'SPCA', '186 Amaral Street', 'Riverside', 'RI', '02915', '(401) 438-8150', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2094, 'Ri Society Prevention Cruelty To Animals', '186 Amaral Street', 'Riverside', 'RI', '02915', '(401) 438-8150', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2095, 'Pals Humane Society Gift & Thrift Shop', '49 Cedar SWamp Road', 'Smithfield', 'RI', '02917', '(401) 231-7580', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2096, 'Animal Rescue League Of Southern Rhode Island - Administrative Office', '24 Salt Pond Road', 'Wakefield', 'RI', '02879', '(401) 792-2233', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2097, 'Stand Up for Animals', '19 Railroad Avenue', 'Westerly', 'RI', '02891', '(401) 348-9595', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2098, 'Woonsocket Cat Sanctuary', '266 Mendon Road', 'Woonsocket', 'RI', '02895', '(401) 765-4174', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2099, 'Woonsocket City - Animal Shelter', '105 Cumberland Hill Road', 'Woonsocket', 'RI', '02895', '(401) 766-6571', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2100, 'Animal Shelter', '615 Highway 28 By-Pass', 'Anderson', 'SC', '29624', '(864) 260-4151', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2101, 'Mamas Animal Shelter', '254 Slow Pitch Road', 'Bamberg', 'SC', '29003', '(803) 245-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2102, 'Barnwell County Government - Animal Shelter', '55 Diamond Road', 'Barnwell', 'SC', '29812', '(803) 259-1656', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2103, 'Bennettsville City - Animal Shelter', '110 Huckabee Street', 'Bennettsville', 'SC', '29512', '(843) 479-7550', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2104, 'Marlboro County - Animal Shelter', '205 East Market Street', 'Bennettsville', 'SC', '29512', '(843) 479-1756', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2105, 'Lee County Animal Shelter', '101 Animal Shelter Lane', 'Bishopville', 'SC', '29010', '(803) 428-2077', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2106, 'Kershaw County - Offices And Agencies, Animal Shelter', '460 Fair Street', 'Camden', 'SC', '29020', '(803) 425-6016', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2107, 'John Ancrum Spca Spay Neuter Clinic', '1610 Sam Rittenberg Boulevard', 'Charleston', 'SC', '29407', '(843) 556-7729', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2108, 'Pet Helpers Adoption Center', '1430 Folly Road', 'Charleston', 'SC', '29412', '(843) 795-1110', 'http://www.pethelpers.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2109, 'Project Pet', '315 Bent Pine Drive', 'Columbia', 'SC', '29201', '(803) 407-0991', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (2110, 'Home Away From Home', '2405 Lakeview Drive', 'Florence', 'SC', '29505', '(843) 665-1615', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2111, 'Stewart Kathy KENL', '2405 Lakeview Drive', 'Florence', 'SC', '29505', '(843) 665-1615', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2112, 'Humane Society of York County', '2036 Carolina Place Drive', 'Fort Mill', 'SC', '29708', '(803) 802-0902', 'http://www.humanesocietyofyorkcountysc.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2113, 'Cherokee County - Animal Shelter', '300 Yale Street', 'Gaffney', 'SC', '29341', '(864) 487-2758', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2114, 'Berkeley County SPCA', '109 Saint James Avenue', 'Goose Creek', 'SC', '29445', '(843) 797-0610', 'http://www.dwspca.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2115, 'Berkley County SPCA', '107 Saint James Avenue', 'Goose Creek', 'SC', '29445', '(843) 572-2144', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2116, 'Hampton County - Community Animal Shelter', '201 Jackson Avenue West', 'Hampton', 'SC', '29924', '(803) 943-7567', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2117, 'Hilton Head Humane Associates', '10 Humane Way', 'Hilton Head Island', 'SC', '29926', '(843) 681-8686', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nIt''s Never Too Late To Get A Date, Lingerie Models\n'); INSERT INTO `default_table` VALUES (2118, 'Animal Protection League', '6080 Old Leesburg Road', 'Hopkins', 'SC', '29061', '(803) 783-2119', 'http://www.aplsc.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2119, 'Feline Refuge', '1812 United Drive', 'Huger', 'SC', '29450', '(843) 336-4790', 'http://www.felinerefuge.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLoving Homes Needed For Cats & Kitchens, Non Kill, Non Caged, Non Profit\n'); INSERT INTO `default_table` VALUES (2120, 'Animal Shelter', '500 Five Forks Road', 'Liberty', 'SC', '29657', '(864) 843-9693', '', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Additional Information:
\nPet Shops, Animal Shelters\n'); INSERT INTO `default_table` VALUES (2121, 'Pickens County Humane Society', '500 Five Forks Road', 'Liberty', 'SC', '29657', '(864) 843-9693', 'http://www.angelfire.com/sc3/takemehome', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDoing Business As Foothills Humane Society, All Adopted Pets Sprayed Or Neutered\n'); INSERT INTO `default_table` VALUES (2122, 'Clarendon County Animal Shelter', '5079 Alex Harvin Highway', 'Manning', 'SC', '29102', '(803) 473-7075', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2123, 'John Ancrum SPCA Adopt-All Center', '535 Long Point Road', 'Mount Pleasant', 'SC', '29464', '(843) 971-7757', 'http://www.jaspca.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2124, 'Lowcountry Cat Practice', '1184 Highway 41', 'Mount Pleasant', 'SC', '29466', '(843) 884-7966', 'http://www.lowcountrycat.com', '', '', 'Morning Appointments', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2125, 'Stroman Sally Dvm', '1184 Highway 41', 'Mount Pleasant', 'SC', '29466', '(843) 884-7966', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2126, 'John Ancrum SPCA Adopt-All Centers', '3861 Leeds Avenue', 'North Charleston', 'SC', '29405', '(843) 747-4849', 'http://www.jaspca.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2127, 'Society for the Prevention of Cruelty To Animals', '3861 Leeds Avenue', 'North Charleston', 'SC', '29405', '(843) 747-4849', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2128, 'Jasper County - Administration, Animal Shelter', '914 Grays Highway', 'Ridgeland', 'SC', '29936', '(843) 726-7799', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2129, 'Jasper L Animal Rescue Mission', '40 South Carters Mill Road', 'Ridgeland', 'SC', '29936', '(843) 726-7799', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2130, 'Gbsi Animal Refuge', '86 Natures Terrace', 'Ridgeville', 'SC', '29472', '(843) 835-4274', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2131, 'Recycled Pets', '1825 West Main Street', 'Rock Hill', 'SC', '29730', '(803) 981-5087', 'http://www.recycledpetsonline.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nRescue & Place Unwanted Pets\n'); INSERT INTO `default_table` VALUES (2132, 'Alive & Well Animal Rescue Center', '1247 Boiling Springs Road', 'Spartanburg', 'SC', '29303', '(864) 591-1556', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2133, 'Spartanburg Humane Society', '150 Dexter Road', 'Spartanburg', 'SC', '29303', '(864) 583-4805', '', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Additional Information:
\nCremation Services, Compassionate Private On Site Cremation, Remembrance Garden, Memorial Markers\n'); INSERT INTO `default_table` VALUES (2134, 'Society for the Prevention of Cruelty To Animals', '1140 South Guignard Drive', 'Sumter', 'SC', '29150', '(803) 773-9292', '', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Additional Information:
\nProfessional Grooming Clipping & Boarding, Spacious Inside Concrete Runs 4''x 8'' Runs For Small To Medium Dogs 6''-8'' Runs For Large Dogs, Spacious Cages For Cats In A Separate Room, Huge Outside... (Show More)\nProfessional Grooming Clipping & Boarding, Spacious Inside Concrete Runs 4''x 8'' Runs For Small To Medium Dogs 6''-8'' Runs For Large Dogs, Spacious Cages For Cats In A Separate Room, Huge Outside (Individual) Exercise Runs - Disinfected After Each Occupant - Completely Safe & Escape Proof, Central Air Conditioning And Heat, Member Of The American Boarding Kennel Association  (Show Less)\n'); INSERT INTO `default_table` VALUES (2135, 'SPCA Humane Organization', '1140 South Guignard Drive', 'Sumter', 'SC', '29150', '(803) 773-9292', '', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Additional Information:
\nSPCA, Humane Organization, MONDAY - SATURDAY 11:00 AM - 1:30PM, 3PM - 5:30PM, CLOSED ON WEDNESDAY & SUNDAY\n'); INSERT INTO `default_table` VALUES (2136, 'Union County - Animal Shelter', '1657 Jonesville Highway', 'Union', 'SC', '29379', '(864) 429-2808', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2137, 'Oconee County Animal Shelter', '321 Camp Road', 'Walhalla', 'SC', '29691', '(864) 638-8798', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2138, 'Twin City Animal Shelter', '722 East Main Street', 'Lead', 'SD', '57754', '(605) 584-2480', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2139, 'Humane Society Adoption Center', '3720 East Benson Road', 'Sioux Falls', 'SD', '57104', '(605) 338-4441', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2140, 'Animalworks', '3377 Regal Drive', 'Alcoa', 'TN', '37701', '(865) 379-2227', 'http://www.animalworks.com', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nLow Cost Spay/Neuter & Vaccinations, Dog & Cat Rescue & Adoption, Non-Profit/No Kill Shelter\n'); INSERT INTO `default_table` VALUES (2141, 'Athens City - Animal Shelter', '219 Alford Street', 'Athens', 'TN', '37303', '(423) 744-2747', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2142, '"Little One''s", Pet Grooming', '3145 lowetown rd', 'baxter', 'TN', '38544', '(931) 858-2828', 'http://littleonespetgrooms.tripod.com', '', '', 'Mon-Sat: 08:00am-05:00pm', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Languages Spoken:
\n\n
Certification & Affiliations:
\n\n'); INSERT INTO `default_table` VALUES (2143, 'Franklin County Humane Society', '9020 David Crockett Highway', 'Belvidere', 'TN', '37306', '(931) 962-4472', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2144, 'Bristol City Of Tennessee - Animal Control', '1140 Vance Drive', 'Bristol', 'TN', '37620', '(423) 989-5537', 'http://bristoltn.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2145, 'Pickett County Humane Society', '401 West Main Street', 'Byrdstown', 'TN', '38549', '(931) 864-8550', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2146, 'Pet Placement Center', '5975 Dayton Boulevard', 'Chattanooga', 'TN', '37415', '(423) 877-0738', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2147, 'Tennessee Humane Animal League', '5975 Dayton Boulevard', 'Chattanooga', 'TN', '37415', '(423) 877-0738', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2148, 'Hamilton County - Humane Society', '212 North Highland Park Avenue', 'Chattanooga', 'TN', '37404', '(423) 624-5302', '', '', '', 'Animal Control-8 To 4:30', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2149, 'Margaret Brock Pet Adoption Center', '214 North Highland Park Avenue', 'Chattanooga', 'TN', '37404', '(423) 622-3738', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2150, 'Humane Educational Society Inc', '214 North Highland Park Avenue', 'Chattanooga', 'TN', '37404', '(423) 698-2525', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nSEVERING HAMILTON COUNTY, Hamilton County Animal Control\n'); INSERT INTO `default_table` VALUES (2151, 'Paws of Peace', '330 Frazier Avenue', 'Chattanooga', 'TN', '37405', '(423) 267-9796', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2152, 'Chattanooga City Government - Public Works, Traffic Signals Signs, Police Dispatcher', '3300 Amnicola Highway Suite A', 'Chattanooga', 'TN', '37406', '(423) 698-2525', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2153, 'St Elmo Animal Shelter', '5405 Bradford Street', 'Chattanooga', 'TN', '37409', '(423) 825-5870', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2154, 'East Ridge City - Animal Shelter, City Judge & Clerk''s Office', '1517 Tombras Avenue', 'Chattanooga', 'TN', '37412', '(423) 867-2701', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2155, 'East Ridge City - Animal Shelter, City Hall', '1517 Tombras Avenue', 'Chattanooga', 'TN', '37412', '(423) 867-7711', 'http://www.eastridgetn.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2156, 'Precious Friends Puppy Rescue & Adoption Program', '110 Red River Street', 'Clarksville', 'TN', '37040', '(931) 551-4407', 'http://www.preciousfriends.org', '', '', '6 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nWanted: Health Puppies, Non-profit Organization\n'); INSERT INTO `default_table` VALUES (2157, 'Animal Control & Adoption Service', '1231 Highway Drive', 'Clarksville', 'TN', '37040', '(931) 648-5750', '', '', '', '6 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nClarksville/Montgomery County, Pet Adoption - Dogs & Cats, Pick Up/Impound Strays, Accept Owner Relinquished Dogs & Cats\n'); INSERT INTO `default_table` VALUES (2158, 'Animal Control & Adoption Service', '1231 Highway Drive', 'Clarksville', 'TN', '37040', '(931) 648-0611', 'http://www.montgomerycountytn.org', '', '', '6 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nClarksville/Montgomery County, Pet Adoption - Dogs & Cats, Pick Up/Impound Strays, Accept Owner Relinquished Dogs & Cats\n'); INSERT INTO `default_table` VALUES (2159, 'Montgomery County - Impound Lot, Rescue Squad, Civil Process, Sheriff''s Department, Records Division', '120 Commerce Street', 'Clarksville', 'TN', '37040', '(931) 648-0611', 'http://www.montgomerycountytn.org', '', '', 'Open 6 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nCLARKSVILLE/MONTGOMERY COUNTY, PET ADOPTION - DOGS & CATS, PICK UP/IMPOUND STRAYS, ACCEPT OWNER RELINQUISHED DOGS & CATS\n'); INSERT INTO `default_table` VALUES (2160, 'Clarksville City - Police Department, Main Number', '135 Commerce Street', 'Clarksville', 'TN', '37040', '(931) 648-0656', '', '', '', 'Open 6 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nCLARKSVILLE/MONTGOMERY COUNTY, PET ADOPTION - DOGS & CATS, PICK UP/IMPOUND STRAYS, ACCEPT OWNER RELINQUISHED DOGS & CATS\n'); INSERT INTO `default_table` VALUES (2161, 'Animal Control & Adoption Service', '135 Commerce Street', 'Clarksville', 'TN', '37040', '(931) 648-0656', '', '', '', 'Monday-Friday 8:00Am-4:00Pm,saturday 9:00Am-1:00Pm,adoptions Monday-Friday 9:00Am-3:00Pm,saturday 9:', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (2162, 'Collierville Town - Administrative Services, Animal Shelter', '500 Poplar View Parkway', 'Collierville', 'TN', '38017', '(901) 457-2200', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2163, 'Maury County - Animal Shelter', '1233 Mapleash Avenue', 'Columbia', 'TN', '38401', '(931) 540-0897', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2164, 'Cookeville Putnam County Animal Shelter', '2105 West Jackson Street', 'Cookeville', 'TN', '38501', '(931) 526-3647', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2165, 'Humane Society Of Cumberland County', '782 East Lane', 'Crossville', 'TN', '38555', '(931) 456-9873', 'http://www.cumberlandhumanesociety.org', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Additional Information:
\nImproving The Lives Of Animals In Cumberland Co, Pet Adoption, Spay & Neuter Programs, Community Education, Volunteer/Membership Opps\n'); INSERT INTO `default_table` VALUES (2166, 'Humane Society Of Cumberland County - Animal Shelter', '782 East Lane', 'Crossville', 'TN', '38555', '(931) 484-9700', 'http://www.cumberlandhumanesociety.org', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nImproving The Lives Of Animals In Cumberland Co, Pet Adoption, Spay & Neuter Programs, Community Education, Volunteer/Membership Opps\n'); INSERT INTO `default_table` VALUES (2167, 'The Road Home Animal Rescue', '4586 Highway 127 South', 'Crossville', 'TN', '38572', '(931) 484-3659', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2168, 'Elizabethton City - Animal Shelter', '253 Sycamore Shoals Drive', 'Elizabethton', 'TN', '37643', '(423) 547-6359', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2169, 'Fayetteville City - Animal Shelter', '1718 Pulaski Highway', 'Fayetteville', 'TN', '37334', '(931) 433-3726', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2170, 'Sumner County - Rabies Control', '635 Long Hollow Pike', 'Gallatin', 'TN', '37066', '(615) 452-2400', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2171, 'Greenbrier Animal Control', '1220 Sugar Camp Drive', 'Greenbrier', 'TN', '37073', '(615) 643-1003', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2172, 'Humane Society Animal Shelter', '950 Hal Henard Road', 'Greeneville', 'TN', '37743', '(423) 639-4771', 'http://www.gchsxtn.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2173, 'Campbell County Government-Animal Shelter', '749 Towe String Road', 'Jacksboro', 'TN', '37757', '(423) 566-1892', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2174, 'Jackson Madison County Rabies Control', '146 Miller Avenue', 'Jackson', 'TN', '38305', '(731) 668-4211', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2175, 'Humane Society Of Jefferson County', '310 Landfill Road', 'Jefferson City', 'TN', '37760', '(865) 475-8930', 'http://www.jeffcohumanesociety.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2176, 'Washington County-Johnson City Animal Control Center', '525 Sells Avenue', 'Johnson City', 'TN', '37604', '(423) 926-8769', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2177, 'Kingsport Civic Auditorium', '1550 Fort Henry Drive', 'Kingsport', 'TN', '37664', '(423) 229-9457', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2178, 'Knoxville City Government - Public Building Authority Telecommunications', '311 Division Street', 'Knoxville', 'TN', '37902', '(865) 215-6599', 'http://www.knoxpets.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nGovernment Offices-City, Village & Township\n'); INSERT INTO `default_table` VALUES (2179, 'Knox County Government - Young-Williams Animal Center, Knoxville Knox County Animal Services', '3201 Division Street', 'Knoxville', 'TN', '37919', '(865) 215-6599', 'http://www.knoxpets.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nGovernment Offices-City, Village & Township\n'); INSERT INTO `default_table` VALUES (2180, 'Adoption Center South', '800 Millwood Road', 'Knoxville', 'TN', '37920', '(865) 573-9674', 'http://www.humanesocietytennessee.com', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nThe Humane Society Of The Tennessee Valley, We Are A No Kill Organization, Fix-A-Pet, Low Cost Spay/Neuter Clinic, The Humane Society Of The Tennessee Valley Protecting Animals Since 1885\n'); INSERT INTO `default_table` VALUES (2181, 'Humane Association of Wilson CO', '507 West Baddour Parkway', 'Lebanon', 'TN', '37087', '(615) 444-1144', 'http://www.hawconline.com', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nThe Humane Association Of Wilson Co, Dogs Cats Puppies & Kittens\n'); INSERT INTO `default_table` VALUES (2182, 'Lewisburg City - Animal Shelter', '300 Woodside Street', 'Lewisburg', 'TN', '37091', '(931) 359-5948', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2183, 'Loudon County Animal Shelter', '480 Rock Quarry Road', 'Loudon', 'TN', '37774', '(865) 458-5593', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2184, 'Madisonville City - Animal Shelter', '101 Training Center Drive', 'Madisonville', 'TN', '37354', '(423) 442-1373', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2185, 'Monroe County Animal Shelter', '170 Kefauver Lane', 'Madisonville', 'TN', '37354', '(423) 442-1015', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2186, 'Coffee County Animal Control', '156 Freedom Drive', 'Manchester', 'TN', '37355', '(931) 723-2730', 'http://www.coffeecountytn.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2187, 'Maryville City Government - Police Department, Animal Shelter', '332 Home Avenue', 'Maryville', 'TN', '37801', '(865) 681-2241', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2188, 'Warren County Humane Society Animal Shelter', '94 Collie', 'Mc Minnville', 'TN', '37110', '(931) 473-5720', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2189, 'Warren County Animal Control', '169 Paws Trail', 'Mc Minnville', 'TN', '37110', '(931) 507-3647', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2190, 'Memphis Humane Society Cat Adoption Center', '710 Philadelphia Street', 'Memphis', 'TN', '38104', '(901) 728-4228', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2191, 'Memphis Humane Society-Cat House', '710 Philadelphia Street', 'Memphis', 'TN', '38104', '(901) 729-4228', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2192, 'Memphis City Government - Animal, Animal Shelter Office', '3456 Tchulahoma Road', 'Memphis', 'TN', '38118', '(901) 362-5310', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2193, 'Sunny Meadows Safe Haven for Pets', '4066 New Getwell Road', 'Memphis', 'TN', '38118', '(901) 363-7233', '', '', '', '', '\nAdditional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (2194, 'Humane Society-Animal Shelter', '300 Dice Street', 'Morristown', 'TN', '37813', '(423) 581-1494', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2195, 'Morristown Hamblen Humane Society', '300 Dice Street', 'Morristown', 'TN', '37813', '(423) 581-1494', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2196, 'Town of Mountain City Animal Shelter', '901 Tobacco Road', 'Mountain City', 'TN', '37683', '(423) 727-7880', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2197, 'Rutherford County Pet Adoption & Welfare Services', '285 John R Rice Boulevard', 'Murfreesboro', 'TN', '37129', '(615) 898-7740', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2198, 'Love at First Sight Pet Adoption Center', '4423 Murphy Road', 'Nashville', 'TN', '37209', '(615) 297-2464', 'http://www.lafspetadoption.com', '', '', '6 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nFree Adorable Healthy Puppies & Kittens, We Accept Healthy Litters For Adoption\n'); INSERT INTO `default_table` VALUES (2199, 'Nashville Humane Association', '213 Oceola Avenue', 'Nashville', 'TN', '37209', '(615) 352-1010', 'http://www.nashvillehumane.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPET ADOPTION, SPAY & NEUTER PROGRAMS PET SURRENDER FOR ADOPTION\n'); INSERT INTO `default_table` VALUES (2200, 'Nashville Humane Association', '213 Oceola Avenue', 'Nashville', 'TN', '37209', '(615) 352-4030', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPET ADOPTION, SPAY & NEUTER PROGRAMS PET SURRENDER FOR ADOPTION\n'); INSERT INTO `default_table` VALUES (2201, 'Oak Ridge City - Animal Shelter, Police Department, Animal Control', '200 South Tulane Avenue', 'Oak Ridge', 'TN', '37830', '(865) 425-3423', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2202, 'Paris City - Animal Shelter', '445 Recycling Drive', 'Paris', 'TN', '38242', '(731) 642-5024', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2203, 'Rockwood City - Animal Shelter', '800 South Chamberlain Avenue', 'Rockwood', 'TN', '37854', '(865) 354-3603', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2204, 'Animal Shelter', '296 Manufacturers Road', 'Rockwood', 'TN', '37854', '(865) 354-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2205, 'Hawkins County Humane Society Inc', '5180 Highway 11W', 'Rogersville', 'TN', '37857', '(423) 272-6538', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2206, 'Savannah City - Animal Shelter Animal Control', '3175 Highway 226', 'Savannah', 'TN', '38372', '(731) 925-3303', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2207, 'Humane Society Animal Shelter', '1117 Oak Cluster Drive', 'Sevierville', 'TN', '37862', '(865) 429-5552', 'http://www.seviercountyhumanesociety.petfinder.com', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLittle Friends Adoption Center, Animal Shelter, Open Tues - Sun 12 PM - 5PM, Adoption Center\n'); INSERT INTO `default_table` VALUES (2208, 'Sevier County Humane Society Animal Shelter - Animal Shelter', '959 Gnatty Branch Road', 'Sevierville', 'TN', '37876', '(865) 453-7000', '', '', '', 'Open Tuesday-Sunday 12:00Pm-5:00Pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLittle Friends Adoption Center, Animal Shelter\n'); INSERT INTO `default_table` VALUES (2209, 'Shelbyville City - Animal Control', '714 Industrial Parkway', 'Shelbyville', 'TN', '37160', '(931) 684-6552', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2210, 'Signal Mountain Adopt-A-Pet', '2805 Kell Road', 'Signal Mountain', 'TN', '37377', '(423) 886-6471', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2211, 'City Of Smithville - Animal Shelter', '535 Shaw Street', 'Smithville', 'TN', '37166', '(615) 597-1363', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2212, 'Animal Shelter', '507 West Main Street', 'Union City', 'TN', '38261', '(731) 885-3690', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2213, 'Waverly Animal Shelter', '108 Young Road', 'Waverly', 'TN', '37185', '(931) 296-7319', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (2214, 'Last Chance', '3701 Plains', 'Amarillo', 'TX', '79102', '(806) 677-0922', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2215, 'SPCA of Brazoria County', '17000 Highway 288B', 'Angleton', 'TX', '77515', '(979) 849-6900', 'http://www.spcabc.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2216, 'Mears Stephanie', '106 E Annie Street', 'Austin', 'TX', '78704', '(512) 445-7311', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2217, 'Austin Zoo', '10807 Rawhide', 'Austin', 'TX', '78736', '(512) 288-2793', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2218, 'Bay City Animal Shelter', '4201 Avenue F', 'Bay City', 'TX', '77414', '(979) 245-1396', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2219, 'SPCA Matagorda County SPCA', '3316 Avenue J', 'Bay City', 'TX', '77414', '(979) 323-8787', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2220, 'Humane Society of Southeast Texas', '2050 Spindletop Avenue', 'Beaumont', 'TX', '77705', '(409) 833-0504', 'http://www.petsforpeople.org', 'suggestions@petsforpeople.org', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2221, 'Boerne Animal Control Facility', '330 South Esser Road', 'Boerne', 'TX', '78006', '(830) 249-2456', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2222, 'Animal Shelter', '1504 East Wise Street', 'Bowie', 'TX', '76230', '(940) 872-2275', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2223, 'Breckenridge City - Animal Shelter', '601 North Dubois Avenue', 'Breckenridge', 'TX', '76424', '(254) 559-1194', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2224, 'City Of Bridge City Animal Shelter', '297 Bower Drive', 'Bridge City', 'TX', '77611', '(409) 735-8898', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2225, 'Sanctuary for Unwanted Animals', '1936 Peach Ridge Road', 'Brookshire', 'TX', '77423', '(281) 375-7787', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2226, 'Sabal Palm Audubon Sanctuary', '8400 Southmost Road', 'Brownsville', 'TX', '78521', '(956) 541-8034', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2227, 'Brazos Animal Shelter', '2207 Finfeather Road', 'Bryan', 'TX', '77801', '(979) 775-5755', 'http://www.shelterpets.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2228, 'Harper H B', '4236 Harper Valley Drive Col', 'Bryan', 'TX', '77801', '(979) 776-1054', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2229, 'Trails End Kennels', '3705 Trails End Road', 'Burleson', 'TX', '76028', '(817) 295-8681', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2230, 'Burnet Animal Shelter City Of', '1330 County Road 340', 'Burnet', 'TX', '78611', '(512) 715-9208', 'http://www.cityofburnet.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2231, 'Canyon Lake Animal Shelter Inc', '5530 Fm 2673', 'Canyon Lake', 'TX', '78133', '(830) 905-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2232, 'Operation Kindness', '3201 Earhart Drive', 'Carrollton', 'TX', '75006', '(972) 418-7297', 'http://www.operationkindness.org', 'info@operationkindness.org', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nCats & Dogs For Adoption, No Kill Animal Shelter, Open Daily\n'); INSERT INTO `default_table` VALUES (2233, 'Lexee''s Legacy Inc', '1437 Halsey Way', 'Carrollton', 'TX', '75007', '(972) 245-0900', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2234, 'Cedar Hill City - Animal Shelter', '1150 East Pleasant Run Road', 'Cedar Hill', 'TX', '75104', '(972) 291-5335', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2235, 'Cleburne-City - Police Services, Animal Shelter', '508 West Industrial Boulevard', 'Cleburne', 'TX', '76033', '(817) 648-0650', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2236, 'Bosque Animal Rescue Kennels Inc', '310 West 5th Street', 'Clifton', 'TX', '76634', '(254) 675-0089', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2237, 'Lake Jackson-City - Humane Department, Animal Shelter Spca', '141 Canna Lane', 'Clute', 'TX', '77531', '(979) 285-2340', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2238, 'Brenham City Of City Hall', '210 N Park Street', 'College Station', 'TX', '77840', '(979) 836-7911', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2239, 'Comanche City - Animal Shelter', '800 East Fleming Avenue', 'Comanche', 'TX', '76442', '(325) 356-5685', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2240, 'Humane Society Of Montgomery County', '1016 East Dallas Street', 'Conroe', 'TX', '77301', '(936) 756-3914', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2241, 'Converse Animal Shelter Inc', '9634 Schaefer Road', 'Converse', 'TX', '78109', '(210) 658-4821', 'http://www.casi.petfinder.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2242, 'Gulf Coast Humane Society', '3118 Cabaniss Road', 'Corpus Christi', 'TX', '78415', '(361) 225-0845', 'http://www.gulfcoasthumane.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nOver 300 Homeless Dogs Cats And Kittens, Desperately Need Caring And Loving Homes, Please Visit Our Shelter And Consider Adding A New Member To Your Family, Adopting An Orphan, Animal Will Give You... (Show More)\nOver 300 Homeless Dogs Cats And Kittens, Desperately Need Caring And Loving Homes, Please Visit Our Shelter And Consider Adding A New Member To Your Family, Adopting An Orphan, Animal Will Give You And Your Family Years Of Enjoyment And Save An Animal''s Life  (Show Less)\n'); INSERT INTO `default_table` VALUES (2243, 'Peewee''s Pet Adoption Inc', '1307 Saratoga Boulevard', 'Corpus Christi', 'TX', '78417', '(361) 888-4141', 'http://www.peeweespets.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2244, 'Noah''s', '18430 Kz Road', 'Cypress', 'TX', '77433', '(281) 351-6624', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2245, 'Canine Workshop Boarding & Training Center', '1538 Prater Street', 'Dallas', 'TX', '75217', '(972) 913-1441', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2246, 'Spca Of Texas', '362 S Industrial Blvd', 'Dallas', 'TX', '75207', '(214) 651-9611', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2247, 'Humane Society of the United States - Southwest Regional Office', '3001 Lyndon B Johnson Freeway Suite 224', 'Dallas', 'TX', '75234', '(972) 488-2964', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2248, 'Spca Of Texas', '4830 Village Fair', 'Dallas', 'TX', '75224', '(214) 372-9999', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2249, 'Del Rio City - Community Health Services, Animal Shelter', '203 Avenue P', 'Del Rio', 'TX', '78840', '(830) 774-8628', 'http://www.cityofdelrio.com', '', '', '7:30 Am To 5:00 Pm Monday Thru Friday', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2250, 'Bay Area Spca', '3000 Avenue R', 'Dickinson', 'TX', '77539', '(281) 339-2086', 'http://www.bayareaspca.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2251, 'Humane Society Of El Paso Inc Animl Care', '325 Shelter Place', 'El Paso', 'TX', '79905', '(915) 532-6971', 'http://www.humanesocietyelpaso.org', '', '', 'M. Monday 8:00a.m.-4:30p.m Tuesday 8:00a.m.-4:30p.m. Wednesday 8:00a.m.-4:30p.m.', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2252, 'Pet Haven', '6750 Westside Drive', 'El Paso', 'TX', '79932', '(915) 877-4545', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2253, 'Eduk9', '3120 Chatsworth', 'Farmers Branch', 'TX', '75234', '(469) 358-1495', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nObedience (All Phases), Protection, Problem Solving, Group Class\n'); INSERT INTO `default_table` VALUES (2254, 'Flower Mound Humane Society', '1601 Arrowhead Drive', 'Flower Mound', 'TX', '75028', '(972) 539-1599', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2255, 'Forney City - Animal Shelter', '1001 Fm 741', 'Forney', 'TX', '75126', '(972) 564-2351', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2256, 'Humane Society of North Texas', '1840 East Lancaster Avenue', 'Fort Worth', 'TX', '76103', '(817) 332-4768', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2257, 'Sansom Park Animal Shelter', '2303 Beverly Hills Drive', 'Fort Worth', 'TX', '76114', '(817) 378-9951', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2258, 'Humane Society Southwest Adoption Center', '6708 South Hulen Street', 'Fort Worth', 'TX', '76133', '(817) 423-3647', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2259, 'American Paint Horse Association', '2800 Meacham Boulevard', 'Fort Worth', 'TX', '76137', '(817) 834-2742', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2260, 'American Llama Farm and Exotic', '6211 Rendon New Hope Road', 'Fort Worth', 'TX', '76140', '(817) 483-9568', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2261, 'Ft Worth Nature Center & Refuge', '9601 Fossil Ridge Road', 'Fort Worth', 'TX', '76135', '(817) 237-1111', 'http://www.naturecenterfriends.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\n4 miles W of I-820, off Hwy 199.\nDescription:
\nA 3,600-acre wildlife habitat. Nature trails, picnicking. Visitor center. (Tues-Sat 9 am-5 pm, Sun noon-5 pm, closed Thanksgiving, Dec 25)\n'); INSERT INTO `default_table` VALUES (2262, 'Spca Hill Country', '2981 South State Highway 16', 'Fredericksburg', 'TX', '78624', '(830) 990-9085', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2263, 'S PCA of Brazoria County', '103 Cherry Street', 'Freeport', 'TX', '77541', '(979) 239-2729', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2264, 'S P C A Thrift Shop', '103 Cherry Street', 'Freeport', 'TX', '77541', '(979) 239-2729', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2265, 'Animal Shelter & Adoption Center Of Galveston Island Inc', '6814 Broadway Street', 'Galveston', 'TX', '77554', '(409) 740-1919', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2266, 'Garland City - Animal Control', '600 Tower Street', 'Garland', 'TX', '75040', '(972) 205-3570', 'http://www.garlandsolidwaste.com', '', '', '', '\nProducts & Services:
\n\n
Languages Spoken:
\n\n
Additional Information:
\nCommercial Solid Waste Services, Fulfilling The Needs Of Our Business And Commercial Community, Industrial And Construction Waste Removal, Guaranteed Service At Competitive Rates, Garland Means... (Show More)\nCommercial Solid Waste Services, Fulfilling The Needs Of Our Business And Commercial Community, Industrial And Construction Waste Removal, Guaranteed Service At Competitive Rates, Garland Means Business, Why We''re The #1 Waste Service In Garland, Commitment To Superior Service, Flexible Pick-Up Schedules, Lower Rates, Multiple Container Discounts, Flat Rates With No Surprises, Rapid Response To Special Needs, Specialized Recycling Programs  (Show Less)\n'); INSERT INTO `default_table` VALUES (2267, 'North Texas Rabbit Sanctuary', '1013 Lesa Lane', 'Garland', 'TX', '75042', '(972) 205-1881', 'http://www.ntrs.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2268, 'Giddings City - Lehman Animal Shelter', '1990 East Leon', 'Giddings', 'TX', '78942', '(979) 540-3919', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2269, 'West Mountain C C', '2 Box 182-B', 'Gilmer', 'TX', '75644', '(903) 734-7375', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2270, 'Home at Last Animal Haven', '5640 County Road 907', 'Godley', 'TX', '76044', '(817) 389-3813', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2271, 'Animal Shelter', '120 Craig Street', 'Graham', 'TX', '76450', '(940) 549-1692', 'http://www.hsyc.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2272, 'Humane Society', '120 Craig Street', 'Graham', 'TX', '76450', '(940) 549-1692', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2273, 'Hood County Animal Shelter', '2885 Fall Creek Highway', 'Granbury', 'TX', '76049', '(817) 326-3647', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2274, 'Friends for Animals', '2885 Fall Creek', 'Granbury', 'TX', '76049', '(817) 326-3647', 'http://www.granburyadoptapet.org', '', '', 'Tuesday-Saturday 12:00Md 5:00Pm', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (2275, 'Hood County - Hood County Animal Shelter', '240 Bray Street', 'Granbury', 'TX', '76048', '(817) 573-4277', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2276, 'Last Chance', '8501 Mitchell Bend Court', 'Granbury', 'TX', '76048', '(817) 573-6830', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2277, 'Paraclesis Christian Counseling', '500 Grapevine Highway Suite 356', 'Grand Prairie', 'TX', '75050', '(817) 320-4673', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2278, 'Grand Saline Animal Shelter', '498 Southeast Pacific', 'Grand Saline', 'TX', '75140', '(903) 962-6905', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2279, 'Haltom City-City - Police Department, Animal Control', '5312 Midway Road', 'Haltom City', 'TX', '76117', '(817) 759-2124', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2280, 'Two Paws Up', '750 South Amy Lane', 'Harker Heights', 'TX', '76548', '(254) 699-6726', 'http://www.webcityonthe.net/twopawsuop', '', '', '24 Hour Emergency Boarding Sunday-Holidays Monday-Tuesday-Thursday 7:30Am-5:00Pm Wednesday-Friday', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2281, 'Clay County Animal Shelter', '509 North Carroll Street', 'Henrietta', 'TX', '76365', '(940) 538-6757', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2282, 'Highland Lakes SPCA', '124 Hills Court', 'Horseshoe Bay', 'TX', '78657', '(830) 596-2717', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2283, 'Noahs Ark Animal Sanctuary', '1118 North Cypress', 'Houston', 'TX', '77001', '(281) 807-7385', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2284, 'German Sheppard Dog Rescue Inc', '12603 Conklin Lane', 'Houston', 'TX', '77034', '(281) 484-1737', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2285, 'Pearland City - Animal Control', '2002 Old Alvin Road', 'Houston', 'TX', '77002', '(281) 652-1970', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2286, 'Houston Humane Society', '1200 McKinney Street', 'Houston', 'TX', '77010', '(713) 571-1966', 'http://www.houstonhumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2287, 'Houston Society For The Prevention Of Cruelty To Animals', '900 Portway Drive', 'Houston', 'TX', '77024', '(713) 869-7722', 'http://www.hspca.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nHOUSTON''S FIRST & LARGEST ANIMAL PROTECTION AGENCY, Devoted to Houston Pet Owners Since 1924, Spay & Neuter Clinic, Sheltering & Counseling, 24 Hour Injured Animal Rescue, Pet Adoptions & Training,... (Show More)\nHOUSTON''S FIRST & LARGEST ANIMAL PROTECTION AGENCY, Devoted to Houston Pet Owners Since 1924, Spay & Neuter Clinic, Sheltering & Counseling, 24 Hour Injured Animal Rescue, Pet Adoptions & Training, Pet Supply and Gift Shop, SOME EVENINGS  (Show Less)\n'); INSERT INTO `default_table` VALUES (2288, 'Greyhound Pets of America Houston Inc', '5602 Royalton Street', 'Houston', 'TX', '77081', '(713) 667-3804', 'http://www.greyhoundpets.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2289, 'Last Chance', '750 Fair', 'Houston', 'TX', '77088', '(281) 447-8851', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2290, 'Houston Humane Society', '14700 Almeda Road', 'Houston', 'TX', '77053', '(713) 433-6421', 'http://www.houstonhumane.org', '', '', 'Tuesday, Wednesday-Friday 10:00am-1:30pm Saturday And Sunday 10:00am-2:00pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt-A-Pet, Wellness Services, Microchipping & Lost & Found, Pet Cemetery & Cremations, LOW COST SPAY & NEUTER CLINIC\n'); INSERT INTO `default_table` VALUES (2291, 'Mr Ks Halfway House For Hounds And Kittys Too Pet Shelter', '9203 Jackrabbit Road', 'Houston', 'TX', '77095', '(281) 463-9884', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2292, 'Citizens for Animal Protection', '11925 Katy Freeway', 'Houston', 'TX', '77079', '(281) 497-0534', 'http://www.cap4pets.org', '', '', '', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nPET ADOPTIONS, WE CARRY A FULL LINE OF PET SUPPLIES & GIFTS, Science Diets, Nutro Max, We Are Always Looking For Volunteers\n'); INSERT INTO `default_table` VALUES (2293, 'Citizens For Animal Protection', '11917 Katy Freeway', 'Houston', 'TX', '77079', '(281) 497-9055', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2294, 'Groomingdale''s', '17904 West Little York Road', 'Houston', 'TX', '77084', '(281) 345-6800', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2295, 'Special Pals', '3830 Greenhouse Road', 'Houston', 'TX', '77084', '(281) 579-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2296, 'Humane Society Rita B Huff', '418 Bearkat Boulevard', 'Huntsville', 'TX', '77340', '(936) 295-4666', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2297, 'Animal Shelter', '1611 West Irving Boulevard', 'Irving', 'TX', '75061', '(972) 253-3333', '', 'info@usdaa.com', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2298, 'Irving Humane Society', '1611 West Irving Boulevard', 'Irving', 'TX', '75061', '(972) 253-3333', 'http://dfwhumane.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2299, 'Irving City - Public Health And Env. Service, Animal Services, Animal Shelter', '100 North Briery Road', 'Irving', 'TX', '75061', '(972) 721-2256', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2300, 'Klein Animal Shelter', '208 West Tena Street', 'Jacksonville', 'TX', '75766', '(903) 586-7336', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2301, 'Animal Shelter', '805 Woodlawn Avenue', 'Jacksonville', 'TX', '75766', '(903) 586-9723', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2302, 'Joshua-City - Animal Shelter', '100 Santa Fe Street', 'Joshua', 'TX', '76058', '(817) 774-9450', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2303, 'City Of Junction Animal Shelter', '1596 East Ranch Road 2169', 'Junction', 'TX', '76849', '(325) 446-9066', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2304, 'Scissors ''N Suds', '225 East Henrietta Avenue', 'Kingsville', 'TX', '78363', '(361) 516-1456', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2305, 'Paws', '500 East Fm 150', 'Kyle', 'TX', '78640', '(512) 268-1611', 'http://www.pawsshelter.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2306, 'Southern Brazoria County Animal Shelter', '141 Canna Lane', 'Lake Jackson', 'TX', '77566', '(979) 285-2340', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2307, 'S P C A Of Brazoria County', '141 Canna Lane', 'Lake Jackson', 'TX', '77566', '(979) 285-2340', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2308, 'Southern Brazoria County Animal Shelter', '141 Canna Lane', 'Lake Jackson', 'TX', '77566', '(979) 285-2089', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2309, 'Laredo Animal Protective Society', '2500 Gonzalez Street', 'Laredo', 'TX', '78040', '(956) 724-8364', 'http://www.laredoanimals.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2310, 'Fayette County Animal Shelter', '240 Svoboda Lane', 'La Grange', 'TX', '78945', '(979) 966-0021', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2311, 'Leander Animal Control', '609 Municipal Drive', 'Leander', 'TX', '78641', '(512) 259-6495', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2312, 'Country Meadows Pet Inn', '3355 West Fm 720', 'Little Elm', 'TX', '75068', '(972) 292-3551', 'http://www.countrymeadowspetinn.com', '', '', '', '\nSpecialties:
\n\n
Additional Information:
\nDog & Cat Short & Long Term Boarding, Climate Controlled Indoor/Outdoor Runs\n'); INSERT INTO `default_table` VALUES (2313, 'Lockhart Animal Shelter', '547 Old McMahan Road', 'Lockhart', 'TX', '78644', '(512) 376-3336', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (2314, 'Animal Control - Gregg County Humane Society', '303 Enterprise Street', 'Longview', 'TX', '75604', '(903) 297-2170', 'http://www.hsgco.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2315, 'Animal Protection League', '705 Gilmer Road', 'Longview', 'TX', '75604', '(903) 753-7387', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLow Cost Spay & Neuter, Low Cost Vaccinations\n'); INSERT INTO `default_table` VALUES (2316, 'Haven Animal Care Shelter', '4501 North Fm 1729', 'Lubbock', 'TX', '79403', '(806) 763-0092', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2317, 'Government Frequently Called Numbers - Animal Shelter', '401 North Ash', 'Lubbock', 'TX', '79403', '(806) 775-2057', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2318, 'Last Chance', '9615 19th Street', 'Lubbock', 'TX', '79407', '(806) 885-4536', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2319, 'O''Malley Alley Cat Organization', '911 Ellis Avenue', 'Lufkin', 'TX', '75904', '(936) 639-5495', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2320, 'Winnie Berry Pet Adoption Center', '1102 North John Redditt Drive', 'Lufkin', 'TX', '75904', '(936) 639-1880', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2321, 'Humane Society Of Angelina County', '1102 N John Redditt Drive', 'Lufkin', 'TX', '75904', '(936) 639-1880', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAt The Humane Society Of Angelina County, Low Cost Pet Adoption, Low Cost Spay / Neuter For Low Income Families, Owner Surrendered Pets Accepted\n'); INSERT INTO `default_table` VALUES (2322, 'Sanctuary Ranch', '16514 County Road 1311', 'Malakoff', 'TX', '75148', '(903) 489-1823', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2323, 'Marshall City - Animal Control Division, Police Department', '607 East End Boulevard South', 'Marshall', 'TX', '75670', '(903) 935-4530', '', '', '', 'Mon-Fri/Weekdays', '\nProducts & Services:
\n\n
Additional Information:
\nHumane Society - Pet Adoption, Spay & Neuter Assistance Program, Holidays & Weekends By Appointment\n'); INSERT INTO `default_table` VALUES (2324, 'Spca Of Texas', '8520 F M Road 720', 'Mckinney', 'TX', '75069', '(972) 562-7387', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2325, 'Spca Of Texas - Main', '8520 F M Road 720', 'Mckinney', 'TX', '75069', '(972) 562-7297', 'http://www.spca.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAdopt A Special Friend This Year, We accept 22000 animals a year regardless of their age health or physical conduct, We fine homes for more than 9000 animals each year a 93% placement of the... (Show More)\nAdopt A Special Friend This Year, We accept 22000 animals a year regardless of their age health or physical conduct, We fine homes for more than 9000 animals each year a 93% placement of the adoptable and treatable animals received annually, We provide affordable spay and neuter surgery sterilizing nearly 60000 animal  (Show Less)\n'); INSERT INTO `default_table` VALUES (2326, 'Carrollton Humane Society', '580 Maple Lane', 'Mc Kinney', 'TX', '75069', '(972) 562-4357', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2327, 'Mesquite City - Community Development, Animal Shelter And Adoption Center', '1650 Gross Road', 'Mesquite', 'TX', '75149', '(972) 216-6283', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2328, 'Lone Star SPCA', '4200 North Fairgrounds Road', 'Midland', 'TX', '79705', '(432) 683-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2329, 'Midland SPCA', '2701 South County Road 1206', 'Midland', 'TX', '79706', '(432) 684-7582', 'http://www.midlandspca.biz', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Adoption, Low Cost Shot Clinic, Low Cost Spay & Neuter\n'); INSERT INTO `default_table` VALUES (2330, 'APET', '915 South Pacific Street', 'Mineola', 'TX', '75773', '(903) 569-1250', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPet Shops\n'); INSERT INTO `default_table` VALUES (2331, 'Mineral Wells City - Animal Shelter', '1302 Northeast 23rd Street', 'Mineral Wells', 'TX', '76067', '(940) 328-7752', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2332, 'Humane Society Animal Shelter', '1920 Kuehler Avenue', 'New Braunfels', 'TX', '78130', '(830) 629-5287', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2333, 'Orange-City - Animal Shelter, Stray Dogs-Dead Animals', '806 Simmons Drive', 'Orange', 'TX', '77630', '(409) 883-1056', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2334, 'Animal Shelter', '119 Euclid', 'Panhandle', 'TX', '79068', '(806) 537-5393', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPet Shops, Animal Shelters\n'); INSERT INTO `default_table` VALUES (2335, 'Pharr-City - Public Works Dept, Animal Control', '801 East Sam Houston Street', 'Pharr', 'TX', '78577', '(956) 702-3647', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2336, 'Second Chance Spca', '505 Alma', 'Plano', 'TX', '75075', '(972) 424-0077', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2337, 'Port Aransas City Of Animal Shelter', '409 West Cotter Avenue', 'Port Aransas', 'TX', '78373', '(361) 749-5941', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2338, 'Port Isabel-City - Animal Shelter', '262 Woody Lane', 'Port Isabel', 'TX', '78578', '(956) 943-3888', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2339, 'Calhoun County Humane Society', '201 Stringham Drive', 'Port Lavaca', 'TX', '77979', '(361) 553-8916', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2340, 'Humane Society', '1308 Myrtle', 'Rockport', 'TX', '78382', '(361) 729-8186', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2341, 'Rockwall City - Animal Shelter', '1600 Airport Road', 'Rockwall', 'TX', '75087', '(972) 771-7750', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2342, 'Royse City Animal Control', '1101 North Josephine Street', 'Royse City', 'TX', '75189', '(972) 635-6609', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2343, 'City Of Sachse Animal Shelter', '6436 Sachse Road', 'Sachse', 'TX', '75048', '(972) 475-3330', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2344, 'Animal Friends Humane Society', '23445 US Highway 281 North', 'San Antonio', 'TX', '78258', '(210) 509-3647', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2345, 'Wildlife Rescue & Rehabilitation', '3 Po Box', 'San Antonio', 'TX', '78291', '(830) 336-2725', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2346, 'Heart Of Texas Greyhound', '24430 Camp Site Road', 'San Antonio', 'TX', '78264', '(210) 621-0123', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2347, 'Pest Shield Pest Control Inc', '15329 Tradesman', 'San Antonio', 'TX', '78249', '(210) 525-8823', 'http://www.pestshieldpestcontrol.com', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nBee Removal, Licensed Professionals\n'); INSERT INTO `default_table` VALUES (2348, 'Humane Society', '4804 Fredericksburg Road', 'San Antonio', 'TX', '78229', '(210) 226-7461', 'http://www.humanesocietyspca.org', '', '', 'Open 6 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSPCA OF BEXAR COUNTY\n'); INSERT INTO `default_table` VALUES (2349, 'Lbj Childres Center Inc', '1030 W Old US Highway 90', 'San Antonio', 'TX', '78237', '(210) 265-8873', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2350, 'Wild Animal Orphanage', '9626 Leslie Road', 'San Antonio', 'TX', '78254', '(210) 688-9038', 'http://www.wildanimalorphanage.org', '', '', 'Call For Hours', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nEXOTIC ANIMAL SANCTUARY, OPEN FOR GUIDED EDUCATIONAL TOURS, CALL FOR HOURS, A Non-Profit Organization\n'); INSERT INTO `default_table` VALUES (2351, 'Animal Sanctuary Of The United States', '9626 Leslie Road', 'San Antonio', 'TX', '78254', '(210) 688-9038', 'http://www.wildanimalorphanage.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nWILD ANIMAL ORPHANAGE, Permanent Sanctuary for Unwanted Exotic Animals, WILDLIFE REHABILITATION, A Non-Profit Organization\n'); INSERT INTO `default_table` VALUES (2352, 'Schertz-City - City Departments, Animal Shelter', '1298 Borgfeld Road', 'Schertz', 'TX', '78154', '(210) 658-6607', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2353, 'Seagoville City - Animal Shelter Msg Center', '110 East Malloy Bridge Road', 'Seagoville', 'TX', '75159', '(972) 287-6821', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2354, 'Buffalo Roam', '8301 Fm 20', 'Seguin', 'TX', '78155', '(830) 303-0190', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2355, 'Snyder City - Animal Shelter', '3706 Brick Plant Road', 'Snyder', 'TX', '79549', '(325) 573-3969', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2356, 'Erath County Humane Society', '891 East Road', 'Stephenville', 'TX', '76401', '(254) 965-3247', 'http://www.erath.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2357, 'Taylor-City - Animal Shelter', '600 East 4', 'Taylor', 'TX', '76574', '(512) 352-5483', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2358, 'Whiskerville Animal Sanctuary Inc', '1112 6th Street North', 'Texas City', 'TX', '77590', '(409) 948-1112', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2359, 'The Colony Animal Shelter', '4720 East Lake Highlands Drive', 'The Colony', 'TX', '75056', '(972) 370-9250', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2360, 'Spca Of Texas', '4720 E Lake Highlands Drive', 'The Colony', 'TX', '75056', '(972) 625-5545', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2361, 'Tiger Creek Wildlife Refuge', '17544 Fm 14', 'Tyler', 'TX', '75706', '(903) 858-1008', 'http://www.tigercreek.org', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Additional Information:
\nVisit The Great Cats\n'); INSERT INTO `default_table` VALUES (2362, 'Universal City-City - Animal Shelter', '262 Kitty Hawk Road', 'Universal City', 'TX', '78148', '(210) 658-0700', 'http://www.universalcitytexas.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2363, 'Uvalde Animal Shelter', '2893 North US Highway 83', 'Uvalde', 'TX', '78801', '(830) 278-1407', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2364, 'AWOS', '12557 Hamp Naylor Drive', 'Vernon', 'TX', '76384', '(940) 552-8600', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2365, 'Wilbarger Humane Society', '2801 Sullivan Street', 'Vernon', 'TX', '76384', '(940) 552-5373', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2366, 'Adopt A Pet', '8215 Houston Highway', 'Victoria', 'TX', '77904', '(361) 575-7387', '', 'adoptpet@icsi.net', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2367, 'Waco Humane Society Animal Shelter', '2032 Circle Road', 'Waco', 'TX', '76706', '(254) 754-1454', 'http://www.wacohumanesociety.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nADOPTIONS - LOST & FOUND\n'); INSERT INTO `default_table` VALUES (2368, 'Fuzzy Friends Rescue', '6321 Airport Road', 'Waco', 'TX', '76708', '(254) 754-9444', 'http://www.fuzzyfriendsrescue.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2369, 'Best Pest Control', '2203 Bosque Boulevard', 'Waco', 'TX', '76707', '(254) 753-4982', '', '', '', '24 Hours a Day', '\nProducts & Services:
\n\n
Specialties:
\n\n
Certification & Affiliations:
\n\n
Additional Information:
\nTermites, Roaches, Ants, Fleas, FHA, VHA Inspections\n'); INSERT INTO `default_table` VALUES (2370, 'Ellis County S P C A', '2750 Fm 878', 'Waxahachie', 'TX', '75165', '(972) 935-0756', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2371, 'Weatherford City - Animal Shelter', '409 Hickory Lane', 'Weatherford', 'TX', '76086', '(817) 598-4111', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2372, 'Free For Life', '543 County Road', 'Whitney', 'TX', '76692', '(254) 694-4513', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2373, 'Animal Reclaim Center', '4360 Old Iowa Park Road', 'Wichita Falls', 'TX', '76305', '(940) 855-6771', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2374, 'Non-Profit Organizations - Humane Society Of Wichita Falls', '4360 Old Iowa Park Road', 'Wichita Falls', 'TX', '76305', '(940) 855-4941', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDogs/Cats For Adoption, Sprayed & Neutered, All Shots, Pure Breeds & All Americans, Adopt A Bundle Of Love & Save A Life\n'); INSERT INTO `default_table` VALUES (2375, 'Winnsboro Animal Shelter', '835 Hope Lane', 'Winnsboro', 'TX', '75494', '(903) 342-3400', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2376, 'Winnsboro City Of', '835 Hope Lane', 'Winnsboro', 'TX', '75494', '(903) 342-3400', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2377, 'Woodville Animal Shelter', '1499 North Magnolia Street', 'Woodville', 'TX', '75979', '(409) 283-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2378, 'In-Sync Exotics Wildlife Rescue', '3430 Skyview Dr', 'Wylie', 'TX', '75098', '(972) 442-6888', 'http://insyncexotics.com', '', '', 'Sat-Sun: 11:00 AM-06:00 PM', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nNon-Profit Organization, Specializing In Rescue Of Exotic Cats\n'); INSERT INTO `default_table` VALUES (2379, 'Brigham City - Animal Shelter', '1220 West Forest', 'Brigham City', 'UT', '84302', '(435) 723-1231', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2380, 'Hurricane City - Dog Pound', '2084 South 700 West', 'Hurricane', 'UT', '84737', '(435) 635-8314', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2381, 'Kanab City - Animal Shelter', '1050 Chinle Drive', 'Kanab', 'UT', '84741', '(435) 644-8057', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2382, 'Best Friends Animal', '5001 Angel Canyon Road', 'Kanab', 'UT', '84741', '(435) 644-2001', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2383, 'North Salt Lake City Government - Animal Shelter Davis County', '1422 East 600 North', 'Kaysville', 'UT', '84037', '(801) 444-2200', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2384, 'Summit County Friends of Animals', '6699 Landmark Drive', 'Park City', 'UT', '84098', '(435) 649-5441', 'http://www.friendsofanimals.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2385, 'Carbon County - Animal Shelter', '3360 South 225 West', 'Price', 'UT', '84501', '(435) 637-6654', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2386, 'Animal Control Shelters - St George', '605 East Skyline Drive', 'Saint George', 'UT', '84770', '(435) 634-5829', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2387, 'Ivins Town - Animal Control', '200 West 450 North', 'Saint George', 'UT', '84770', '(435) 628-1049', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2388, 'Haws Fence Co', '1705 Creek Road', 'Sandy', 'UT', '84093', '(801) 942-1963', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAll Types Of Fencing, Wood, Chain Link\n'); INSERT INTO `default_table` VALUES (2389, 'Sevier County - Animal Shelter', '2555 North 200 East', 'Sigurd', 'UT', '84657', '(435) 896-5370', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2390, 'Tooele City - Animal Shelter', '3300 North 1200 West', 'Tooele', 'UT', '84074', '(435) 882-4607', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2391, 'Animal Shelter', '1387 East 335 South', 'Vernal', 'UT', '84078', '(435) 781-7297', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2392, 'Uintah Animal Shelter', '1387 East 335 South', 'Vernal', 'UT', '84078', '(435) 781-6369', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2393, 'Collie Rescue League of New England', '869 Lake Morey Road', 'Bradford', 'VT', '05033', '(802) 222-5124', 'http://www.collie.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2394, 'Green Mountain Animal Defenders', '21 Church Street', 'Burlington', 'VT', '05401', '(802) 861-3030', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Protection Organizations\n'); INSERT INTO `default_table` VALUES (2395, 'New England Animal Health Institute', '1847 Trebo Road', 'Chester', 'VT', '05143', '(802) 875-4889', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2396, 'North Country Animal League', '3524 Laporte Road', 'Morrisville', 'VT', '05661', '(802) 888-5065', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2397, 'Rutland County Humane Society', '765 Stevens Road', 'Pittsford', 'VT', '05763', '(802) 483-6700', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2398, 'Second Chance Animal Center - Administration', '6779 Vt Route 7A', 'Shaftsbury', 'VT', '05262', '(802) 375-0249', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2399, 'Humane Society of Chittenden County', '142 Kindness Court', 'South Burlington', 'VT', '05403', '(802) 862-0135', 'http://www.chittendenhumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2400, 'Animal Assistance League', '1149 New Mill Drive', 'Chesapeake', 'VA', '23322', '(757) 548-0045', 'http://www.animalassistanceleague.com', '', 'Please click the business profile link.', 'Mon-Sun: 12:00pm-05:00pm', '\nProducts & Services:
\n\n
Languages Spoken:
\n\n
Additional Information:
\nOpen For Adoption 7 Days A Week, From 12 Noon To 5 pm Daily\n'); INSERT INTO `default_table` VALUES (2401, 'Washington County - Animal Shelter', '27252 Porter Lane', 'Abingdon', 'VA', '24211', '(276) 669-7037', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2402, 'Washington County - Animal Shelter', '27252 Porter Lane', 'Abingdon', 'VA', '24211', '(276) 676-6210', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2403, 'Frnds-Animal Shelter', '39710 Goodpuppy Lane', 'Aldie', 'VA', '20105', '(703) 327-4530', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2404, 'Homeward Trails', '822 North Daniel Street', 'Arlington', 'VA', '22201', '(703) 766-2647', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (2405, 'Animal Welfare League Of Arlington VA', '2650 South Arlington Mill Drive', 'Arlington', 'VA', '22202', '(703) 931-9241', 'http://www.awla.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2406, 'Wildlife Care Alliance', '1160 Overstreet Creek Road', 'Bedford', 'VA', '24523', '(540) 587-4007', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2407, 'Bedford County - Animal Shelter', '1307 Falling Creek Road', 'Bedford', 'VA', '24523', '(540) 586-7690', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2408, 'Spay Neuter All Pets Society', '2643 Old Cox Road', 'Boydton', 'VA', '23917', '(434) 738-0738', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2409, 'SPCA', '2075 Woodburn', 'Charlottesville', 'VA', '22901', '(434) 973-5959', 'http://www.caspca.org', '', '', '6 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSociety For Prevention Of Cruelty To Animals\n'); INSERT INTO `default_table` VALUES (2410, 'Albemarle County - Spca Charlottesville Albemarle', '3355 Berkmar Drive', 'Charlottesville', 'VA', '22901', '(434) 973-5959', 'http://www.caspca.org', '', '', '7 Days a Week/Daily/Everyday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSociety For Prevention Of Cruelty To Animals\n'); INSERT INTO `default_table` VALUES (2411, 'Animal Assistance League', '1149 New Mill Drive', 'Chesapeake', 'VA', '23322', '(757) 548-0045', 'http://www.animalassistanceleague.com', '', 'Please click the business profile link.', 'Mon-Sun: 12:00pm-05:00pm', '\nProducts & Services:
\n\n
Languages Spoken:
\n\n
Additional Information:
\nOpen For Adoption 7 Days A Week, From 12 Noon To 5 pm Daily\n'); INSERT INTO `default_table` VALUES (2412, 'Culpeper County Animal Shelter', '10144 James Monroe Highway', 'Culpeper', 'VA', '22701', '(540) 547-4477', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2413, 'Dachshund Rescue of North America, Inc', '12106 Greenway Court 101', 'Fairfax', 'VA', '22033', '(703) 383-9480', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2414, 'Ferrets R No 1 Shelter & Rescue', '5906 Boston Drive', 'Falls Church', 'VA', '22041', '(703) 998-3151', 'http://www.ferretsr1.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2415, 'City of Franklin', '1024 Pretlow Street', 'Franklin', 'VA', '23851', '(757) 562-8605', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2416, 'Humane Society Of Warren Co', '1245 Progress Road', 'Front Royal', 'VA', '22630', '(540) 635-4734', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2417, 'Galax-Carrol-Grayson Animal Shelter', '200 Fair Street', 'Galax', 'VA', '24333', '(276) 236-8501', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2418, 'Friends United With the Richmond Shelter', '4660 Pouncey Tract Road', 'Glen Allen', 'VA', '23059', '(804) 364-1944', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2419, 'Cat Corner', '85 Fulton Street', 'Hampton', 'VA', '23663', '(757) 722-0590', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2420, 'Animal Aid Society', '8 Butler Farm Road', 'Hampton', 'VA', '23666', '(757) 865-0511', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2421, 'SPCA', '2238 Old Furnace Road', 'Harrisonburg', 'VA', '22801', '(540) 434-5270', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2422, 'Willets Creek Grooming', '8202 Severn Drive', 'Hayes', 'VA', '23072', '(804) 642-1021', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2423, 'Corner Cuts', '2145 Airport', 'Hillsville', 'VA', '24343', '(276) 728-7724', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2424, 'Brunswick Co Animal Shelter', '595 Planters Road', 'Lawrenceville', 'VA', '23868', '(434) 848-0912', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2425, 'Spca Shelter', '10 Animal Place', 'Lexington', 'VA', '24450', '(540) 463-5123', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2426, 'Snap Inc', '7218 Courthouse Road', 'Louisa', 'VA', '23093', '(540) 967-3573', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (2427, 'Humane Society Spca Of Nelson County', '29 Stagebridge Road', 'Lovingston', 'VA', '22949', '(434) 263-7722', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (2428, 'City Of Manassas Animal Shelter', '10039 Dean Drive', 'Manassas', 'VA', '20110', '(703) 257-2420', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2429, 'Spca Dgn', '848 Freestate Road', 'Meherrin', 'VA', '23954', '(434) 736-9595', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2430, 'Peninsula Spca', '523 J Clyde Morris Boulevard', 'Newport News', 'VA', '23601', '(757) 595-1399', 'http://www.peninsulaspca.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt Your New Best Friend From The SPCA, Spay & Neuter Your Pets\n'); INSERT INTO `default_table` VALUES (2431, 'Spca Of Norfolk', '916 Ballentine Boulevard', 'Norfolk', 'VA', '23504', '(757) 622-3319', 'http://www.norfolkspca.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2432, 'Society For Prevention Cruelty To Animals', '916 Ballentine Boulevard', 'Norfolk', 'VA', '23504', '(757) 622-3319', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2433, 'Humane Society', '916 Ballentine Boulevard', 'Norfolk', 'VA', '23504', '(757) 622-3319', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2434, 'Caring for Creatures', '352 Sanctuary Lane', 'Palmyra', 'VA', '22963', '(434) 842-2404', 'http://www.caringforcreatures.com', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nNon-Profit Organizations\n'); INSERT INTO `default_table` VALUES (2435, 'Portsmouth Humane Society', '2704 Frederick Boulevard', 'Portsmouth', 'VA', '23704', '(757) 397-6004', 'http://www.portshumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2436, 'Safe Haven Inc', '211 Turner Road', 'Richmond', 'VA', '23225', '(804) 745-9830', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2437, 'Roanoke City - Animal Control, City Animal Shelter, Lost-Found Animals', '1340 Baldwin Avenue Northeast', 'Roanoke', 'VA', '24012', '(540) 344-4840', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2438, 'Laughing Horse Sanctuary', '8317 Grassland Drive', 'Sandy Level', 'VA', '24161', '(434) 927-5298', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2439, 'SPCA', '33 Archery Lane', 'Staunton', 'VA', '24401', '(540) 885-7722', 'http://www.caspca.org', 'caspca@cstone.net', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2440, 'Lunenburg County Animal Shelter', '1320 Old Mansion Road', 'Victoria', 'VA', '23974', '(434) 696-5529', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2441, 'Humane Society SPCA', '3040 Holland Road', 'Virginia Beach', 'VA', '23453', '(757) 427-0070', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2442, 'Spca Virginia Beach', '3040 Holland Road', 'Virginia Beach', 'VA', '23453', '(757) 427-0070', 'http://www.vbspca.com', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2443, 'Heritage Humane Society', '430 Waller Mill Rd', 'Williamsburg', 'VA', '23185', '(757) 221-0150', 'http://www.heritagehumanesociety.org', '', '', '8am-9pm Monday-Friday 10am-6pm Sat.', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nBREED RESCUE\n'); INSERT INTO `default_table` VALUES (2444, 'SPCA', '115 Featherbed Lane', 'Winchester', 'VA', '22601', '(540) 662-8616', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2445, 'Homeward Pet Adoption Center', '18800 Woodinville Snohomish Rd Ne', 'Woodinville', 'WA', '98072', '(425) 488-4444', 'http://www.homewardpet.org', 'admin@hottervillesafehaus.org', '', 'Noon To 6pm Saturday And Sunday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nFormerly Hooterville Pet, Adoption Center, A Non-Profit, All Purchases Help, Support Homeless, Pet Programs\n'); INSERT INTO `default_table` VALUES (2446, 'Paws G H', '800 West 1st Street', 'Aberdeen', 'WA', '98520', '(360) 532-3127', '', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nDedicated To Animal Rescue Since 1971, Pet Day Wed & Fri 11-3, Bring In Aluminum Cans For Recycle\n'); INSERT INTO `default_table` VALUES (2447, 'Paws G H', '800 West 1st Street', 'Aberdeen', 'WA', '98520', '(360) 533-1141', 'http://www.paws.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDedicated To Animal Rescue Since 1971, Pet Day Wed & Fri 11-3, Bring In Aluminum Cans For Recycle\n'); INSERT INTO `default_table` VALUES (2448, 'Humane Society At Happypaws Farm', '19933 Old Burn Road', 'Arlington', 'WA', '98223', '(360) 652-5844', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2449, 'Animal Control & Protection - Sarvey Wildlife Center', '13106 148th Street Northeast', 'Arlington', 'WA', '98223', '(360) 435-4817', 'http://www.sarveywildlife.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nOrphaned & Injured Wildlife Only, Ambulance Service Covers Skagit Snohomish King & Pierce Counties\n'); INSERT INTO `default_table` VALUES (2450, 'Island Wildlife Rehabilitation Center at Bloedel', '7501 Northeast Dolphin Drive', 'Bainbridge Island', 'WA', '98110', '(206) 855-9057', 'http://www.islandwildlife.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2451, 'Humane Society For Seattle King County', '13212 Southeast Eastgate Way', 'Bellevue', 'WA', '98005', '(425) 641-0080', 'http://www.seattlehumane.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nSpay/Neuter Clinic, Lost/Found Reports, Cremation, Dog Training, Providing Service Since 1897\n'); INSERT INTO `default_table` VALUES (2452, 'Ssp-Preferred Animal Care', '641 Baker Creek Lane', 'Bellingham', 'WA', '98225', '(360) 647-2443', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2453, 'Whatcom Humane Society Animal Shelter - County Line', '3710 Williamson', 'Bellingham', 'WA', '98226', '(360) 384-3056', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2454, 'Humane Society Animal Shelter - Animal Control Licensing', '3710 Williamson Way', 'Bellingham', 'WA', '98226', '(360) 733-2080', 'http://www.whatcomhumane.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2455, 'Humane Society Of Skagit Valley', '18911 Kelleher Road', 'Burlington', 'WA', '98233', '(360) 757-0445', 'http://www.skagithumane.com', 'web@skagithumane.com', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2456, 'Camano Animal Shelter Associates', '160 Can Ku Road', 'Camano Island', 'WA', '98282', '(360) 387-1902', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2457, 'Lewis County Animal Shelter', '560 Centralia Alpha Road', 'Chehalis', 'WA', '98532', '(360) 740-1290', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2458, 'Clarkston City - Animal Shelter Department', '102 13th Street', 'Clarkston', 'WA', '99403', '(509) 758-1675', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2459, 'Dog Patch Group Inc', '2307 Hickey Way', 'Colville', 'WA', '99114', '(509) 684-5433', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2460, 'Waif', '20168 State Route 20', 'Coupeville', 'WA', '98239', '(360) 678-5816', 'http://www.waifanimals.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2461, 'Paws - Information Lost & Found', '800 West 1st', 'Elma', 'WA', '98541', '(360) 482-6521', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2462, 'Everett Animal Shelter', '2732 36th Street', 'Everett', 'WA', '98201', '(425) 257-6000', '', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2463, 'Everett City Of', '2732 36th Street', 'Everett', 'WA', '98201', '(425) 257-6000', '', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (2464, 'Forks Animals Friends Of', '71 Calawah Way', 'Forks', 'WA', '98331', '(360) 374-3332', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2465, 'Animal Shelter', '00 North 2nd Street', 'Friday Harbor', 'WA', '98250', '(360) 378-8755', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2466, 'Petsmart', '15615 E Droadway Avenue', 'Greenacres', 'WA', '99016', '(509) 927-9223', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2467, 'Benton-Franklin Humane Society', '8620 West Gage Boulevard', 'Kennewick', 'WA', '99336', '(509) 374-4235', 'http://www.bfhs.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2468, 'MEOW Cat Rescue', '10600 Northeast 68th Street', 'Kirkland', 'WA', '98033', '(425) 822-6369', 'http://www.meowcatrescue.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2469, 'Humane Society Of Cowlitz County & Animal Control Center', '909 Columbia Boulevard', 'Longview', 'WA', '98632', '(360) 577-0151', 'http://www.cowlitzhumane.com', '', '', 'Open 6 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPRIVATE PET CREMATION AVAILABLE\n'); INSERT INTO `default_table` VALUES (2470, 'Humane Society of Pacific County', '324 2nd Street Northeast', 'Long Beach', 'WA', '98631', '(360) 642-1180', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2471, 'Paws', '15305 44th Avenue West', 'Lynnwood', 'WA', '98087', '(425) 787-2500', 'http://www.paws.org', '', '', 'Tuesday And Wednesday 12 P.m.-6 P.m. Thursday And Friday 12 P.m.-7 P.m. Saturday And Sunday 11 A.m.-', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nShelter, Wildlife Rehabilitation, Education & Outreach\n'); INSERT INTO `default_table` VALUES (2472, 'Snohomish County - Animal Control, Complaints, Animal Shelter Contractors, South County', '15305 44th Avenue West', 'Lynnwood', 'WA', '98087', '(425) 787-2500', 'http://www.paws.org', '', '', 'Tuesday And Wednesday 12 P.m.-6 P.m. Thursday And Friday 12 P.m.-7 P.m. Saturday And Sunday 11 A.m.-', '\nProducts & Services:
\n\n
Additional Information:
\nCompanion Animal Shelter, Animal Advocacy\n'); INSERT INTO `default_table` VALUES (2473, 'Second Chance Ranch', '19527 Southeast 237th Street', 'Maple Valley', 'WA', '98038', '(425) 432-4433', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2474, 'Rescue Pup', '800 164th Street Southeast Suite M', 'Mill Creek', 'WA', '98012', '(425) 742-6072', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2475, 'Wildlife Care Clinic', '33285 State Route 20', 'Oak Harbor', 'WA', '98277', '(360) 240-1060', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2476, 'Okanogan County Animal Foster Care Association', '4 Spring Coulee Road', 'Okanogan', 'WA', '98840', '(509) 422-3364', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2477, 'Animal Services', '3120 Martin Way East', 'Olympia', 'WA', '98506', '(360) 352-2510', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2478, 'Lacey City Of', '3120 East Martin Way', 'Olympia', 'WA', '98506', '(360) 352-2510', '', '', '', '', '\nSpecialties:
\n\n'); INSERT INTO `default_table` VALUES (2479, 'Jcso Animal Services', '105 County Landfill Road', 'Port Townsend', 'WA', '98368', '(360) 385-3292', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2480, 'Jefferson Co Animal Control', '112 Critter Lane', 'Port Townsend', 'WA', '98368', '(360) 385-3292', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2481, 'Puyallup City - Animal Shelter', '1200 39th Avenue Southeast', 'Puyallup', 'WA', '98374', '(253) 841-5595', 'http://www.ci.puyallup.wa.us', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2482, 'Puyallup Summer Animal Control & Adoptions', '1200 Southeast 39th Avenue', 'Puyallup', 'WA', '98374', '(253) 841-5595', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2483, '2nd Chance Ranch Of Jefferson County', '11900 Center Road', 'Quilcene', 'WA', '98376', '(360) 765-0598', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2484, 'Paws Cat City', '8503 Greenwood Avenue North', 'Seattle', 'WA', '98103', '(206) 782-1700', 'http://www.paws.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2485, 'Bernard Law Group', '900 Aurora Avenue North', 'Seattle', 'WA', '98109', '(206) 838-4900', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2486, 'Pasados Safe Haven', '7400 Northeast Sand Point Way', 'Seattle', 'WA', '98115', '(206) 525-5186', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2487, 'Barking Dog Alehouse', '705 Northwest 70th Street', 'Seattle', 'WA', '98117', '(206) 782-2974', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2488, 'Barking Dog Alehouse', '705 NW 70th Street', 'Seattle', 'WA', '98117', '(206) 782-2674', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2489, 'Seattle Animal Shelter', '2061 15th Avenue West', 'Seattle', 'WA', '98119', '(206) 386-7387', 'http://www.seattleanimalshelter.org', '', '', 'Closed Mondays', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nWe''re Not Just The Pound Anymore, Over 30 Years Of Compassion, Lots Of Loving Companion Animals Available For Adoption, Puppies, Kittens, Small Critters, Foster Opportunities Available\n'); INSERT INTO `default_table` VALUES (2490, 'Seattle Emergency Housing', '1025 E Fir Street', 'Seattle', 'WA', '98122', '(206) 264-4918', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2491, 'Best Little Rabbit Rodent & Ferret House', '14317 Lake City Way Northeast', 'Seattle', 'WA', '98125', '(206) 365-9105', 'http://www.rabbitrodentferret.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2492, 'Country Critters Rescue Corral', '26024 Helmick Road', 'Sedro Woolley', 'WA', '98284', '(360) 854-0205', 'http://www.countrycritters.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2493, 'Kitten Rescue Of Mason County', '420 SE State Route 3', 'Shelton', 'WA', '98584', '(360) 426-2455', 'http://www.kittenrescue.net', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nFeline Rescue & Adoption\n'); INSERT INTO `default_table` VALUES (2494, 'Humane Society Kitsap', '9167 Dickey Road Northwest', 'Silverdale', 'WA', '98383', '(360) 692-6977', 'http://www.kitsaphumane.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPet Adoption Program, Cat & Dog Licensing, 24 Hour Lost Pet Line, Euthanasia/Cremation Services, Low Cost Spay / Neuter\n'); INSERT INTO `default_table` VALUES (2495, 'Ferret Haven', '2411 West Rowan Avenue', 'Spokane', 'WA', '99205', '(509) 326-2779', 'http://ferrethaven.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2496, 'Spokane Humane Society', '6607 North Havana Street', 'Spokane', 'WA', '99217', '(509) 467-5235', 'http://www.spokanehumanesociety.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nCompanion Animals For Adoption, Spay/Neuter Clinic Serves, Qualified Low Income Households\n'); INSERT INTO `default_table` VALUES (2497, 'Spokanimal Care', '710 North Napa Street', 'Spokane', 'WA', '99202', '(509) 534-8133', 'http://www.spokanimal.org', '', '', '24 Hour Lost Pet Hotline', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPets For Adoption, Low Fees Spay & Neuter Clinic, Animal Control & License\n'); INSERT INTO `default_table` VALUES (2498, 'Spokane County Regional Animal Protection Service-Scraps', '2521 North Flora Road', 'Spokane Valley', 'WA', '99216', '(509) 477-2532', 'http://www.spokanecounty.org', '', '', '24 Hour Lost Pets Hotline', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLovable & Affordable, Dogs & Cats For Adoption, Pet Licensing\n'); INSERT INTO `default_table` VALUES (2499, 'Spokane County Regional Animal Protection Service-Scraps', '2521 North Flora Road', 'Spokane Valley', 'WA', '99216', '(509) 477-8100', 'http://www.spokanecounty.org', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPet Licensing, Dogs & Cats For Adoption\n'); INSERT INTO `default_table` VALUES (2500, 'Partners For Pets', '8901 East Trent Avenue', 'Spokane Valley', 'WA', '99212', '(509) 893-9829', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2501, 'Humane Society for Southwest Washington SPCA', '2121 Street Francis Lane', 'Vancouver', 'WA', '98660', '(360) 693-4746', 'http://www.sw-wa-humanesociety.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nSmall Animals, Adoption Fee Includes, Free First Inoculations, Free Health Exam - Wormed, Free ID Tag, Free Visit To Veterinarian, Free Microchip & Registration\n'); INSERT INTO `default_table` VALUES (2502, 'Animal Shelter Wenatchee Valley Humane Society', '1474 South Wenatchee Avenue', 'Wenatchee', 'WA', '98801', '(509) 662-9577', 'http://www.wenatcheehumane.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nPet Adoptions, Volunteer Opportunities Available\n'); INSERT INTO `default_table` VALUES (2503, 'Homeward Pet Adoption Center', '18800 Woodinville Snohomish Rd Ne', 'Woodinville', 'WA', '98072', '(425) 488-4444', 'http://www.homewardpet.org', 'admin@hottervillesafehaus.org', '', 'Noon To 6pm Saturday And Sunday', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nFormerly Hooterville Pet, Adoption Center, A Non-Profit, All Purchases Help, Support Homeless, Pet Programs\n'); INSERT INTO `default_table` VALUES (2504, 'Humane Society Shelter', '2405 Birchfield Road', 'Yakima', 'WA', '98901', '(509) 457-6854', '', '', '', '', '\nProducts & Services:
\n\n
Brands:
\n\n'); INSERT INTO `default_table` VALUES (2505, 'Mecer County Humane Society', '6069 Po Box', 'Bluefield', 'WV', '24701', '(304) 327-8336', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2506, 'Kanawha Charleston Humane Association Animal Shelter', '1248 Greenbrier Street', 'Charleston', 'WV', '25311', '(304) 342-1576', 'http://www.wvanimalshelter.com', '', 'Established in 1996', 'M-F 9am-5pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2507, 'Briggs Animal Adoption Center', '3794 Barryville Park', 'Charles Town', 'WV', '25414', '(304) 724-6558', 'http://www.baacs.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2508, 'Animal Kingdom', '2500 Fairmont Avenue', 'Fairmont', 'WV', '26554', '(304) 366-4366', '', '', 'One-Stop Pet Shop', 'M-Sat 9am-6pm', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nQuality Live Pets, Fish - Reptiles - Birds, Dogs - Cats - Exotic Pets\n'); INSERT INTO `default_table` VALUES (2509, 'Huntington Cabell Wayne Animal Control', '1901 James River Road', 'Huntington', 'WV', '25701', '(304) 696-5551', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2510, 'Roane County Animal Shelter', '2550 Parkersburg Road', 'Spencer', 'WV', '25276', '(304) 927-2555', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2511, 'Braxton County Animal Shelter', '10 Animal Shelter Lane', 'Sutton', 'WV', '26601', '(304) 765-2200', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2512, 'Touch By A Paw Cat Shelter', '182 W Main St', 'Whitewater', 'WI', '53190', '(262) 473-4769', 'http://www.touchedbyapaw.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2513, 'Whitetails Unlimited Inc', '2767 Oakridge Court', 'Appleton', 'WI', '54915', '(920) 687-1099', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2514, 'Chequamegon Humane Assoc.', '405 Old Airport Road', 'Ashland', 'WI', '54806', '(715) 682-9744', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2515, 'Village Veterinary Clinic Sc', '103 Mutzy Lane', 'Bonduel', 'WI', '54107', '(715) 758-8031', '', '', '', 'Hours by Appointment', '\nProducts & Services:
\n\n
Brands:
\n\n
Specialties:
\n\n
Additional Information:
\nVeterinarians, Large, Small & Exotic Animals, We Carry A Variety Of Pet Products, Science Prescription Diets\n'); INSERT INTO `default_table` VALUES (2516, 'Yerks Loren A DVM', '103 Mutzy Lane', 'Bonduel', 'WI', '54107', '(715) 758-8031', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nVeterinarians, Large, Small & Exotic Animals, We Carry A Variety Of Pet Products, Science Prescription Diets\n'); INSERT INTO `default_table` VALUES (2517, 'Ewing Emma Dvm Veterinarian OFC', '103 Mutzy Lane', 'Bonduel', 'WI', '54107', '(715) 758-8031', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2518, 'Ferret Nook', '1957 Hillside Road', 'Cambridge', 'WI', '53523', '(608) 423-3315', 'http://www.ferretnook.com', 'ferretnook@smallbytes.net', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2519, 'Ozaukee Humane Society Inc', '2073 Washington Avenue', 'Cedarburg', 'WI', '53012', '(262) 377-7580', 'http://www.azaukeehumane.org', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAnimal Shelter Open\n'); INSERT INTO `default_table` VALUES (2520, 'Eastshore Humane Association', '1100 Park Street', 'Chilton', 'WI', '53014', '(920) 849-2390', 'http://www.petfinder.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2521, 'Forest County Humane Society', '701 Industrial Park Way', 'Crandon', 'WI', '54520', '(715) 478-2098', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2522, 'Quality Electric', '6394 State Road 11', 'Delavan', 'WI', '53115', '(262) 728-2392', '', '', '', '', '\nProducts & Services:
\n\n
Payment Options:
\n\n
Additional Information:
\nResidential - Light Commercial - Remodeling - Service Upgrades-New Home Guarantee - 5 Yrs\n'); INSERT INTO `default_table` VALUES (2523, 'Lakeland Animal Shelter', '3551 State Road 67', 'Delavan', 'WI', '53115', '(262) 723-1000', 'http://www.lakelandanimalshelter.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2524, 'Lakeland Animal Shelter - Fax Line', '3551 State Road 67', 'Delavan', 'WI', '53115', '(262) 723-1001', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2525, 'Lakeland Animal Shelter', '3551 State Road 67', 'Delavan', 'WI', '53115', '(262) 723-7387', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2526, 'Pepin County Humane Society & Animal Shelter', '1008 West Wells Street', 'Durand', 'WI', '54736', '(715) 672-8389', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2527, 'Humane Society of Vilas CO', '2477 US Highway 45 North', 'Eagle River', 'WI', '54521', '(715) 479-9777', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2528, 'Animal Shelter', '3900 Old Town Hall Road', 'Eau Claire', 'WI', '54701', '(715) 839-4747', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2529, 'Eau Claire County Humane Association', '3900 Old Town Hall Road', 'Eau Claire', 'WI', '54701', '(715) 839-4747', 'http://www.eccha.org', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2530, 'Freedom House', '2997 Saint Anthony Drive', 'Green Bay', 'WI', '54311', '(920) 406-2956', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2531, 'Web of Life Environmental Education Center Inc', '1664 Friess Lake Road', 'Hubertus', 'WI', '53033', '(262) 628-0885', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2532, 'Humane Society of Rock County', '222 South Arch Street', 'Janesville', 'WI', '53548', '(608) 752-5622', 'http://www.rockcountyhumanesociety.com', '', '', 'Tues-sun 1:00pm-5:00pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2533, 'Society Of St Francis Animal Shelter', '12300 116th Street', 'Kenosha', 'WI', '53142', '(262) 857-7260', 'http://www.saintfrancissociety.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nDog Boarding Daily Walks & Loving Care\n'); INSERT INTO `default_table` VALUES (2534, 'Safe Harbor Humane Society', '7811 60th Avenue', 'Kenosha', 'WI', '53142', '(262) 694-4047', 'http://www.kenoshahumanesociety.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2535, 'Kenosha County Humane Society Animal Shelter', '7811 60th Avenue', 'Kenosha', 'WI', '53142', '(262) 694-4047', 'http://www.kenoshahumanesociety.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2536, 'Kindred Kitties', '614 59th Street', 'Kenosha', 'WI', '53140', '(262) 605-0533', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2537, 'Wanekia Wanagi Domestic Animal Shelter', '18436 County Road Xx', 'Kiel', 'WI', '53042', '(920) 894-2247', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (2538, 'Bill Jordan Wildlife Defense Fund Usa', '6425 Odana Road', 'Madison', 'WI', '53719', '(608) 442-3536', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2539, 'Wisconsin Rottweiler Rescue', '3617 South Dutch Mill Road', 'Madison', 'WI', '53718', '(608) 224-0272', 'http://www.wirottrescue.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2540, 'Dane County Humane Society', '5132 Voges Road', 'Madison', 'WI', '53718', '(608) 838-0413', 'http://www.giveshelter.org', '', '', '6 Days a Week', '\nProducts & Services:
\n\n
Additional Information:
\nClose Wednesdays, Weekends 12\n'); INSERT INTO `default_table` VALUES (2541, 'Lakeshore Humane Society Inc', '1551 North 8th Street', 'Manitowoc', 'WI', '54220', '(920) 684-5401', 'http://www.lhs.petfinder.com', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2542, 'Kiedrowicz Ra', '3369 West Mequon Road', 'Mequon', 'WI', '53092', '(262) 242-9232', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nAnimal Shelters\n'); INSERT INTO `default_table` VALUES (2543, 'Kiedrowicz Christine M', '3369 W Mequon Road', 'Mequon', 'WI', '53092', '(262) 242-9232', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2544, 'Fine Feathered Friends', '2410 F Daniels Street', 'Middleton', 'WI', '53562', '(608) 222-6420', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2545, 'Elijahs Hse Of Peace 2', '613 E Pleasant Street', 'Milwaukee', 'WI', '53202', '(414) 319-1076', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2546, 'R I M M Inc', '2832 N 13th Street', 'Milwaukee', 'WI', '53206', '(414) 562-0735', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2547, 'Second Hand Purrs', '4300 South Howell Avenue', 'Milwaukee', 'WI', '53207', '(414) 727-7877', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2548, 'Humane Society-Wisconsin', '4500 West Wisconsin Avenue', 'Milwaukee', 'WI', '53208', '(414) 264-6257', 'http://www.wihumane.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n'); INSERT INTO `default_table` VALUES (2549, 'Resurrection House Inc', '4950 N 20th Street', 'Milwaukee', 'WI', '53209', '(414) 263-0163', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2550, 'Alternative Housing Inc', '2554 N Bartlett Avenue', 'Milwaukee', 'WI', '53211', '(414) 963-9925', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2551, 'Elijahs House Of Peace', '610 W Hadley Street', 'Milwaukee', 'WI', '53212', '(414) 372-9166', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2552, 'Elijahs Ministries', '8702 W Portage Street', 'Milwaukee', 'WI', '53224', '(414) 357-6792', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2553, 'Shady Acres Animal Shelter', '623 East Shady Lane', 'Neenah', 'WI', '54956', '(920) 725-0002', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2554, 'Animal Welfare Shelter', '951 County Road G', 'Neenah', 'WI', '54956', '(920) 722-9544', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2555, 'Animal Shelter', '1925 Shelter Court', 'Oshkosh', 'WI', '54901', '(920) 424-2128', 'http://www.oahs.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2556, 'Oshkosh Area Humane Society', '1925 Shelter Court', 'Oshkosh', 'WI', '54901', '(920) 424-2128', 'http://www.oahs.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2557, 'Hope Safehouse', '1911 Taylor Avenue', 'Racine', 'WI', '53403', '(262) 634-4571', 'http://www.hopesafehouse.org', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2558, 'Homeward Bound Of Racine County Inc', '1014 Drive Martin Luther King Drive', 'Racine', 'WI', '53404', '(262) 633-3290', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2559, 'Countryside Humane Society', '2706 Chicory Road', 'Racine', 'WI', '53403', '(262) 554-6699', 'http://www.countrysidehumanesociety.org', '', '', 'Weekdays 1 Pm-4 Pm Weekdays Noon To 5 Pm Weekdays Noon To 5 Pm Saturday 11 Am-1 Pm', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2560, 'Rhinelander Animal Shelter', '1852 North Stevens Street', 'Rhinelander', 'WI', '54501', '(715) 362-5992', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2561, 'Sheboygan County Humane Society', '3107 North 20th Street', 'Sheboygan', 'WI', '53083', '(920) 458-2012', 'http://www.sheboyganchs.org', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Payment Options:
\n\n
Additional Information:
\nSave A Life, Adopt A Pet, Before You Buy Visit Us\n'); INSERT INTO `default_table` VALUES (2562, 'Washington County Humane Society', '3650 State Road 60', 'Slinger', 'WI', '53086', '(262) 677-4388', 'http://www.washingtoncountyhumane.org', '', '', 'Open Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nCremation Services Available\n'); INSERT INTO `default_table` VALUES (2563, 'Portage County Humane Society Inc', '106 Bukolt Park', 'Stevens Point', 'WI', '54481', '(715) 344-6012', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2564, 'Bat Conservation Of Wi', '2956 Fern Drive', 'Sun Prairie', 'WI', '53590', '(608) 837-2287', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2565, 'Animal Rescue Federation Care & Adoption Center', '2225 Hill Avenue', 'Superior', 'WI', '54880', '(715) 394-7387', 'http://www.animalrescuefederation.com', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nFormerly The Superior Animal Center, Providing Care & Adoption For Pets\n'); INSERT INTO `default_table` VALUES (2566, 'Angels Wish', '161 Horizon Drive', 'Verona', 'WI', '53593', '(608) 848-4174', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2567, 'Humane Animal Welfare Society of Waukesha County', '701 Northview Road', 'Waukesha', 'WI', '53188', '(262) 542-8851', 'http://www.hawspets.org', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nAdopt A Pet, Cats Dogs Rabbits Guinea Pigs & More, Pet Behavior & Training Classes, Low Adoption Fees Include Spay-Neuter And Micro-Chip ID\n'); INSERT INTO `default_table` VALUES (2568, 'Puppyland Humane Society Inc', '3456 County D', 'West Bend', 'WI', '53090', '(262) 338-3369', 'http://www.nonkill.com', '', '', 'Monday-Friday 3:30Pm-5:00Pm,daily 10:00Am-12:00Am Noon', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2569, 'Touch By A Paw Cat Shelter', '182 W Main St', 'Whitewater', 'WI', '53190', '(262) 473-4769', 'http://www.touchedbyapaw.net', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2570, 'St Francis Animal Shelter Inc', '109 Flatiron Drive', 'Buffalo', 'WY', '82834', '(307) 684-1738', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2571, 'Metro Animal Control Center', '2392 East Metro Road', 'Casper', 'WY', '82601', '(307) 235-8398', 'http://www.fortcasparwyoming.com', '', '', 'Open 7 Days a Week', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2572, 'Campbell County Of - Gillette - Sheriff, Animal Control', '950 West Warlow Drive', 'Gillette', 'WY', '82716', '(307) 686-5249', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2573, 'Animal Shelter Jackson Teton County Wyoming', '3150 Adams Canyon', 'Jackson', 'WY', '83001', '(307) 733-2139', '', '', '', 'Mon-Sat', '\nProducts & Services:
\n\n
Specialties:
\n\n
Additional Information:
\nLost & Found Animals, Dog & Cat Adoptions/Surrenders, Equipment Loans, Licenses\n'); INSERT INTO `default_table` VALUES (2574, 'Animal Shelter', '1064 North 5th Street', 'Laramie', 'WY', '82072', '(307) 721-5385', '', '', '', '', '\nProducts & Services:
\n\n
Additional Information:
\nPet Shops, Animal Shelters\n'); INSERT INTO `default_table` VALUES (2575, 'Weston County Humane Society & Animal - Shelter', '115 West Cambria Street', 'Newcastle', 'WY', '82701', '(307) 746-9770', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2576, 'Powell City Government - Animal Shelter', '638 West North Street', 'Powell', 'WY', '82435', '(307) 754-1019', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2577, 'Riverton City Animal Shelter', '515 South Smith Road', 'Riverton', 'WY', '82501', '(307) 857-6002', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2578, 'Dog & Cat Shelter', '84 East Ridge Road', 'Sheridan', 'WY', '82801', '(307) 674-7694', 'http://dogandcatshelter.org', '', '', '', '\nProducts & Services:
\n\n
Specialties:
\n\n'); INSERT INTO `default_table` VALUES (2579, 'Wyoming Sheltie Rescue', '648 North US Highway 20', 'Thermopolis', 'WY', '82443', '(307) 864-4019', '', '', '', '', ''); INSERT INTO `default_table` VALUES (2580, 'Waggin'' Tails Shelter', '980 11th Avenue East', 'Torrington', 'WY', '82240', '(307) 532-5373', '', '', '', '', '\nProducts & Services:
\n\n'); INSERT INTO `default_table` VALUES (2581, 'Wheatland Animal Shelter', '58 Front Road', 'Wheatland', 'WY', '82201', '(307) 322-4868', '', '', '', '', '\nProducts & Services:
\n\n');